![Western Blot: HCLS1 Antibody (1A8) [H00003059-M02] - Analysis of HCLS1 expression in transfected 293T cell line by HCLS1 monoclonal antibody (M02), clone 1A8.Lane 1: HCLS1 transfected lysate(54 KDa).Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/HCLS1-Antibody-1A8-Western-Blot-H00003059-M02-img0014.jpg "Western Blot: HCLS1 Antibody (1A8) [H00003059-M02] - Analysis of HCLS1 expression in transfected 293T cell line by HCLS1 monoclonal antibody (M02), clone 1A8.Lane 1: HCLS1 transfected lysate(54 KDa).Lane 2: Non-transfected lysate.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ELISA, Func, IHC, KD |
| Clone | 1A8 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Description | Quality control test: Antibody Reactive Against Recombinant Protein. |
| Immunogen | HCLS1 (AAH16758, 266 a.a. ~ 355 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. QERKAVTKRSPEAPQPVIAMEEPAVPAPLPKKISSEAWPPVGTPPSSESEPVRTSREHPVPLLPIRQTLPEDNEEPPALPPRTLEGLQVE |
| Specificity | HCLS1 (1A8) |
| Isotype | IgG1 Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | HCLS1 |
| Purity | IgG purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IHC-P, RNAi Validation and ELISA. |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | IgG purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for HCLS1 Antibody (H00003059-M02)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry-Paraffin: HCLS1 Antibody (1A8) [H00003059-M02] - Analysis of monoclonal antibody to HCLS1 on formalin-fixed paraffin-embedded human tonsil. Antibody concentration 3 ug/ml.](http://images.novusbio.com/fullsize/HCLS1-Antibody-1A8-Immunohistochemistry-Paraffin-H00003059-M02-img0010.jpg "Immunohistochemistry-Paraffin: HCLS1 Antibody (1A8) [H00003059-M02] - Analysis of monoclonal antibody to HCLS1 on formalin-fixed paraffin-embedded human tonsil. Antibody concentration 3 ug/ml.")
![Western Blot: HCLS1 Antibody (1A8) [H00003059-M02] - Analysis of HCLS1 over-expressed 293 cell line, cotransfected with HCLS1 Validated Chimera RNAi ( Cat # H00003059-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with HCLS1 monoclonal antibody (M02), clone 1A8 (Cat # H00003059-M02 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.](http://images.novusbio.com/fullsize/HCLS1-Antibody-1A8-Western-Blot-H00003059-M02-img0011.jpg "Western Blot: HCLS1 Antibody (1A8) [H00003059-M02] - Analysis of HCLS1 over-expressed 293 cell line, cotransfected with HCLS1 Validated Chimera RNAi ( Cat # H00003059-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with HCLS1 monoclonal antibody (M02), clone 1A8 (Cat # H00003059-M02 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.")
![Western Blot: HCLS1 Antibody (1A8) [H00003059-M02] - HCLS1 monoclonal antibody (M02), clone 1A8 Analysis of HCLS1 expression in K-562.](http://images.novusbio.com/fullsize/HCLS1-Antibody-1A8-Western-Blot-H00003059-M02-img0013.jpg "Western Blot: HCLS1 Antibody (1A8) [H00003059-M02] - HCLS1 monoclonal antibody (M02), clone 1A8 Analysis of HCLS1 expression in K-562.")
![Proximity Ligation Assay: HCLS1 Antibody (1A8) [H00003059-M02] - Analysis of protein-protein interactions between CASP3 and HCLS1. HeLa cells were stained with anti-CASP3 rabbit purified polyclonal 1:1200 and anti-HCLS1 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).](http://images.novusbio.com/fullsize/HCLS1-Antibody-1A8-Proximity-Ligation-Assay-H00003059-M02-img0008.jpg "Proximity Ligation Assay: HCLS1 Antibody (1A8) [H00003059-M02] - Analysis of protein-protein interactions between CASP3 and HCLS1. HeLa cells were stained with anti-CASP3 rabbit purified polyclonal 1:1200 and anti-HCLS1 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).")
![Sandwich ELISA: HCLS1 Antibody (1A8) [H00003059-M02] - Detection limit for recombinant GST tagged HCLS1 is approximately 0.1ng/ml as a capture antibody.](http://images.novusbio.com/fullsize/HCLS1-Antibody-1A8-Sandwich-ELISA-H00003059-M02-img0012.jpg "Sandwich ELISA: HCLS1 Antibody (1A8) [H00003059-M02] - Detection limit for recombinant GST tagged HCLS1 is approximately 0.1ng/ml as a capture antibody.")
![Immunohistochemistry NGFR/TNFRSF16/p75NTR Antibody [Unconjugated]](https://images.novusbio.com/images2/NGF_R_AF1157_Immunohistochemistry_6685.jpg)
![Western Blot NGFR/TNFRSF16/p75NTR Antibody [Unconjugated]](https://images.novusbio.com/images2/NGF_R_AF1157_Western_Blot_17941.jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![N/A BDNF [HRP]](https://images.novusbio.com/images2/DATA_BDNF_DBD00_ELISA_587.jpg)
![N/A BDNF [HRP]](https://images.novusbio.com/images2/DATA_BDNF_DBD00_ELISA_588.jpg)
![N/A BDNF [HRP]](https://images.novusbio.com/images2/BDNF_DBD00_ELISA_36.jpg)
![N/A TNF RI/TNFRSF1A [HRP]](https://images.novusbio.com/images2/DATA_TNF_RI_DRT100_ELISA_815.jpg)
![N/A TNF RI/TNFRSF1A [HRP]](https://images.novusbio.com/images2/DATA_TNF_RI_DRT100_ELISA_816.jpg)
![N/A TNF RI/TNFRSF1A [HRP]](https://images.novusbio.com/images2/TNF_RI_DRT100_ELISA_175.jpg)
![Immunohistochemistry TrkA Antibody [Unconjugated]](https://images.novusbio.com/images2/TrkA_AF1056_Immunohistochemistry_6672.jpg)
![Western Blot TrkA Antibody [Unconjugated]](https://images.novusbio.com/images2/TrkA_AF1056_Western_Blot_17300.jpg)
![Immunohistochemistry TrkA Antibody [Unconjugated]](https://images.novusbio.com/images/af1056_rat-trka-affinity-purified-polyclonal-ab-8220249503264.jpg)
![N/A CD25/IL-2R alpha [HRP]](https://images.novusbio.com/images2/IL-2_R_alpha_DR2A00_ELISA_167.jpg)
![N/A CD25/IL-2R alpha [HRP]](https://images.novusbio.com/images2/DATA_CD25_DR2A00_ELISA_800.jpg)
![Simple Western Fascin Antibody (833223) [Unconjugated]](https://images.novusbio.com/images2/Fascin_MAB7745_Simple_Western_16531.jpg)
![Knockout Validated Fascin Antibody (833223) [Unconjugated]](https://images.novusbio.com/images2/Fascin_MAB7745_Knockout_Validated_23042.jpg)
![Immunohistochemistry Fascin Antibody (833223) [Unconjugated]](https://images.novusbio.com/images2/Fascin_MAB7745_Immunohistochemistry_12950.jpg)
![Western Blot PI 3-Kinase p55 gamma Antibody (668619) [Unconjugated]](https://images.novusbio.com/images2/PI_3-Kinase_p55_gamma_MAB6638_Western_Blot_10569.jpg)
![Bioactivity IL-2 [Unconjugated]](https://images.novusbio.com/images/202-il_recombinant-human-il-2-protein-bioactivity-174202314946.jpg)
![SDS-PAGE beta-NGF [Unconjugated]](https://images.novusbio.com/images2/beta-NGF_256-GF_321.jpg)
![Bioactivity beta-NGF [Unconjugated]](https://images.novusbio.com/images2/beta-NGF_256-GF_322.jpg)
![Bioactivity CTLA-4 [Unconjugated]](https://images.novusbio.com/images2/CTLA4_7268CT_2293.jpg)
![Flow Cytometry: Mouse IgG1 Kappa Isotype Control (P3.6.2.8.1) [NBP1-43319] - Analysis of Alexa Fluor (R) 700 conjugate of NBP1-43319. Human buffy coat stained with mouse IgG1 Kappa isotype control. Flow cytometry image submitted by a verified customer review.](https://images.novusbio.com/images/Mouse-IgG1-Kappa-Light-Chain-Isotype-Control-P3-6-2-8-1-Flow-Cytometry-NBP1-43319-img0002.jpg "Flow Cytometry: Mouse IgG1 Kappa Isotype Control (P3.6.2.8.1) [NBP1-43319] - Analysis of Alexa Fluor (R) 700 conjugate of NBP1-43319. Human buffy coat stained with mouse IgG1 Kappa isotype control. Flow cytometry image submitted by a verified customer review.")