Home » Torsin A » Torsin A Proteins » Torsin A Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

Torsin A Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for Torsin A Recombinant Protein Antigen (NBP2-56137PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Torsin A Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Torsin A.

Source: E. coli

Amino Acid Sequence: QAVEPISLGLALAGVLTGYIYPRLYCLFAECCGQKRSLSREALQKDLDDNLFGQHLAKK

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
TOR1A
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-56137.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Torsin A Recombinant Protein Antigen

  • DQ2Torsin family 1 member A
  • Dystonia 1 protein
  • dystonia 1, torsion (autosomal dominant; torsin A)
  • DYT1torsin-1A
  • torsin family 1, member A (torsin A)

Background

The protein encoded by the Torsin A gene is a member of the AAA family of adenosine triphosphatases (ATPases), is related tothe Clp protease/heat shock family and is expressed prominently in the substantia nigra pars compacta. Mutations inthis gene result in the autosomal dominant disorder, torsion dystonia 1. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Recombinant Human
HLA DRB4 GST (N-Term) ...
H00003126-P01
Other Recombinant Human HLA DRB4 GST (N-Term) Protein
(1 Publication)
Species: Hu
Applications: ELISA, AP, PA, WB
THAP1 Antibody
H00055145-D01P
Western Blot THAP1 Antibody
Western Blot THAP1 Antibody
(1 Publication)
Species: Hu, Rt
Applications: ICC/IF, IHC, WB

epsilon-Sarcoglycan An
NBP1-59794
Immunohistochemistry epsilon-Sarcoglycan Antibody
Western Blot epsilon-Sarcoglycan Antibody
Western Blot epsilon-Sarcoglycan Antibody
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Torsin 1B Antibody
NBP1-84984
Immunohistochemistry-Paraffin Torsin 1B Antibody
Immunohistochemistry-Paraffin Torsin 1B Antibody
Immunohistochemistry-Paraffin Torsin 1B Antibody
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
HLA DRB3 Antibody
(Bra30)
NBP3-07168
HLA DRB3 Antibody (Bra30)
Species: Pm, Ca, Pm, Hu, Pm, Sq
Applications: Flow, ICC/IF
TRAILR1/TNFRSF10A
Antibody [Unconjugate ...
AF347
Neutralization TRAILR1/TNFRSF10A Antibody [Unconjugated]
Western Blot TRAILR1/TNFRSF10A Antibody [Unconjugated]
Immunohistochemistry TRAILR1/TNFRSF10A Antibody [Unconjugated]
(38 Publications)
Species: Hu
Applications: IHC, Neut, WB
DR3/TNFRSF25
[Unconjugated]
943-D3
DR3/TNFRSF25 [Unconjugated]
(7 Publications)
Species: Hu
Applications: Bind
Transglutaminase
2/TGM2 Antibody [Unco ...
AF4376
Western Blot Transglutaminase 2/TGM2 Antibody [Unconjugated]
Simple Western Transglutaminase 2/TGM2 Antibody [Unconjugated]
Knockout Validated Transglutaminase 2/TGM2 Antibody [Unconjugated]
(3 Publications)
Species: Hu, Mu, Rt
Applications: IP, KO, Simple Western, WB
GCH1 Antibody
NBP1-84949
Immunohistochemistry-Paraffin GCH1 Antibody
Immunohistochemistry-Paraffin GCH1 Antibody
Immunohistochemistry-Paraffin GCH1 Antibody
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P
LRP2 Antibody
(CD7D5) - Azide and B ...
NB110-96417
Immunocytochemistry/ Immunofluorescence LRP2 Antibody (CD7D5) - Azide and BSA Free
Immunohistochemistry LRP2 Antibody (CD7D5) - Azide and BSA Free
Immunohistochemistry-Paraffin LRP2 Antibody (CD7D5) - Azide and BSA Free
(1 Review)
(21 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
MCF2L Antibody
(1D11)
H00023263-M01
Sandwich ELISA MCF2L Antibody (1D11)
Immunohistochemistry-Paraffin MCF2L Antibody (1D11)
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB

CAMP/LL37/FALL39/Cathe ...
NBP1-76864
Immunohistochemistry-Paraffin CAMP/LL37/FALL39/Cathelicidin Antibody - BSA Free
Western Blot CAMP/LL37/FALL39/Cathelicidin Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence CAMP/LL37/FALL39/Cathelicidin Antibody - BSA Free
(3 Publications)
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
MHC Class I
Antibody (OX18) - BSA
NB120-6405
Flow Cytometry MHC Class I Antibody (OX18) - BSA Free
Immunocytochemistry/ Immunofluorescence MHC Class I Antibody (OX18) - BSA Free
Immunocytochemistry/ Immunofluorescence MHC Class I Antibody (OX18) - BSA Free
(36 Publications)
Species: Rt
Applications: B/N, CyTOF-ready, EM, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
HLA DRB1 Antibody
(SPM288)
NBP2-45312
Immunohistochemistry-Paraffin HLA DRB1 Antibody (SPM288)
Flow Cytometry HLA DRB1 Antibody (SPM288)
Immunofluorescence HLA DRB1 Antibody (SPM288)
(2 Publications)
Species: Hu, Pm, Mu(-)
Applications: Flow, ICC/IF, IHC, IHC-P, WB
HLA B Antibody
(2G7B10) - BSA Free
NBP2-61871
ELISA HLA B Antibody (2G7B10) - BSA Free
Flow Cytometry HLA B Antibody (2G7B10) - BSA Free
Immunocytochemistry/ Immunofluorescence HLA B Antibody (2G7B10) - BSA Free
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(817 Publications)
Species: Hu
Applications: BA
PKR Antibody
(HL71/10) [Unconjugat
MAB1980
Simple Western PKR Antibody (HL71/10) [Unconjugated]
Immunocytochemistry PKR Antibody (HL71/10) [Unconjugated]
Western Blot PKR Antibody (HL71/10) [Unconjugated]
(9 Publications)
Species: Hu
Applications: ICC, IP, Simple Western, WB
CTLA-4
[Unconjugated]
7268-CT
Bioactivity CTLA-4 [Unconjugated]
(3 Publications)
Species: Hu
Applications: BA
Sodium Potassium
ATPase Alpha 3 Antibo ...
NB300-540
Immunocytochemistry/ Immunofluorescence Sodium Potassium ATPase Alpha 3 Antibody (XVIF9-G10) - BSA Free
Immunocytochemistry/ Immunofluorescence Sodium Potassium ATPase Alpha 3 Antibody (XVIF9-G10) - BSA Free
Immunocytochemistry/ Immunofluorescence Sodium Potassium ATPase Alpha 3 Antibody (XVIF9-G10) - BSA Free
(2 Reviews)
(21 Publications)
Species: Bv, Ca, Gp, Hu, Mu, Pm, Rb, Rt, Sh
Applications: B/N, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, Single-Cell Western, WB
Torsin A
Recombinant Protein A
NBP2-56137PEP
Torsin A Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for Torsin A Recombinant Protein Antigen (NBP2-56137PEP) (0)

There are no publications for Torsin A Recombinant Protein Antigen (NBP2-56137PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Torsin A Recombinant Protein Antigen (NBP2-56137PEP) (0)

There are no reviews for Torsin A Recombinant Protein Antigen (NBP2-56137PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Torsin A Recombinant Protein Antigen (NBP2-56137PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Torsin A Products

Research Areas for Torsin A Recombinant Protein Antigen (NBP2-56137PEP)

Find related products by research area.

Blogs on Torsin A

There are no specific blogs for Torsin A, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Torsin A Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol TOR1A