![Immunocytochemistry/Immunofluorescence: GCH1 Antibody [NBP1-84949] - Staining of human cell line U-251 MG shows localization to nucleoplasm & cytosol. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/GCH1-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-84949-img0008.jpg "Immunocytochemistry/Immunofluorescence: GCH1 Antibody [NBP1-84949] - Staining of human cell line U-251 MG shows localization to nucleoplasm & cytosol. Antibody staining is shown in green.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: ELNLPNLAAAYSSILSSLGENPQRQGLLKTPWRAASAMQFFTKGYQETISDVLNDAIFDEDHDEMVIVKDIDMFSMCEHHLVPFVGKVHIGYLPNKQVLGLSKLARIVEIYSRRLQVQE |
| Predicted Species | Mouse (93%), Rat (97%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | GCH1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: PFA/Triton X-100 |
||
| Theoretical MW | 28 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Simple Western GCHFR Antibody (846011) [Unconjugated]](https://images.novusbio.com/images2/GCHFR_MAB7918_Simple_Western_16530.jpg)
![Western Blot GCHFR Antibody (846011) [Unconjugated]](https://images.novusbio.com/images2/GCHFR_MAB7918_Western_Blot_13066.jpg)
| Publication using NBP1-84949 | Applications | Species |
|---|---|---|
| Cronin SJF, Rao S, Tejada MA et al. Phenotypic drug screen uncovers the metabolic GCH1/BH4 pathway as key regulator of EGFR/KRAS-mediated neuropathic pain and lung cancer Science Translational Medicine 2022-08-31 [PMID: 36044597] (Western Blot) | Western Blot |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry-Paraffin: GCH1 Antibody [NBP1-84949] - Staining of human liver shows moderate cytoplasmic positivity in hepatocytes.](http://images.novusbio.com/fullsize/antibody/nbp1-84949_rabbit-polyclonal-gch1-antibody-immunohistochemistry-paraffin-174202412156..jpg "Immunohistochemistry-Paraffin: GCH1 Antibody [NBP1-84949] - Staining of human liver shows moderate cytoplasmic positivity in hepatocytes.")
![Immunohistochemistry-Paraffin: GCH1 Antibody [NBP1-84949] - Staining of human skeletal muscle shows very weak positivity in myocytes as expected.](http://images.novusbio.com/fullsize/antibody/nbp1-84949_rabbit-polyclonal-gch1-antibody-immunohistochemistry-paraffin-1742024121555..jpg "Immunohistochemistry-Paraffin: GCH1 Antibody [NBP1-84949] - Staining of human skeletal muscle shows very weak positivity in myocytes as expected.")
![Immunohistochemistry-Paraffin: GCH1 Antibody [NBP1-84949] -Staining of human pancreas shows strong cytoplasmic and nuclear positivity in islets of Langerhans.](http://images.novusbio.com/fullsize/antibody/nbp1-84949_rabbit-polyclonal-gch1-antibody-immunohistochemistry-paraffin-1742024121648..jpg "Immunohistochemistry-Paraffin: GCH1 Antibody [NBP1-84949] -Staining of human pancreas shows strong cytoplasmic and nuclear positivity in islets of Langerhans.")
![Immunohistochemistry-Paraffin: GCH1 Antibody [NBP1-84949] -Staining of human duodenum shows strong cytoplasmic positivity in enteroendocrine cells.](http://images.novusbio.com/fullsize/antibody/nbp1-84949_rabbit-polyclonal-gch1-antibody-immunohistochemistry-paraffin-1742024121747..jpg "Immunohistochemistry-Paraffin: GCH1 Antibody [NBP1-84949] -Staining of human duodenum shows strong cytoplasmic positivity in enteroendocrine cells.")
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![Western Blot Dopa Decarboxylase/DDC Antibody [Unconjugated]](https://images.novusbio.com/images2/Dopa_Decarboxylase_AF3564_Western_Blot_17092.jpg)
![Immunohistochemistry Dopa Decarboxylase/DDC Antibody [Unconjugated]](https://images.novusbio.com/images2/Dopa_Decarboxylase_AF3564_Immunohistochemistry_19241.jpg)
![Immunohistochemistry Dopa Decarboxylase/DDC Antibody [Unconjugated]](https://images.novusbio.com/images2/Dopa_Decarboxylase_AF3564_Immunohistochemistry_19242.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")