![Western Blot: THAP1 Antibody [H00055145-D01P] - Analysis of THAP1 expression in Jurkat.](http://images.novusbio.com/fullsize/THAP1-Antibody-Western-Blot-H00055145-D01P-img0003.jpg "Western Blot: THAP1 Antibody [H00055145-D01P] - Analysis of THAP1 expression in Jurkat.")
| Reactivity | Hu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | THAP1 (NP_060575.1, 1 a.a. - 213 a.a.) full-length human protein. MVQSCSAYGCKNRYDKDKPVSFHKFPLTRPSLCKEWEAAVRRKNFKPTKYSSICSEHFTPDCFKRECNNKLLKENAVPTIFLCTEPHDKKEDLLEPQEQLPPPPLPPPVSQVDAAIGLLMPPLQTPVNLSVFCDHNYTVEDTMHQRKRIHQLEQQVEKLRKKLKTAQQRCRRQERQLEKLKEVVHFQKEKDDVSERGYVILPNDYFEIVEVPA |
| Specificity | THAP1 - THAP domain containing, apoptosis associated protein 1, |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | THAP1 |
| Purity | Protein A purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Application Notes | Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control. Immunocytochemistry/Immunofluorescence and Immunohistochemistrywere reported in scientific literature. |
|
| Publications |
|
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.4) |
| Preservative | No Preservative |
| Purity | Protein A purified |
| Publication using H00055145-D01P | Applications | Species |
|---|---|---|
| Zhao Y, Xiao J, Gong S et al. Neural expression of the transcription factor THAP1 during development in rat Neuroscience 2012-12-05 [PMID: 23219941] (IF/IHC, ICC/IF, WB, Human, Rat) | IF/IHC, ICC/IF, WB | Human, Rat |
Secondary Antibodies |
Isotype Controls |
Research Areas for THAP1 Antibody (H00055145-D01P)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | THAP1 |
| Entrez |
|
| Uniprot |
|
![Western Blot: THAP1 Antibody [H00055145-D01P] - Analysis of THAP1 expression in transfected 293T cell line by THAP1 polyclonal antibody.Lane 1: THAP1 transfected lysate(24.90 KDa).Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/THAP1-Antibody-Western-Blot-H00055145-D01P-img0004.jpg "Western Blot: THAP1 Antibody [H00055145-D01P] - Analysis of THAP1 expression in transfected 293T cell line by THAP1 polyclonal antibody.Lane 1: THAP1 transfected lysate(24.90 KDa).Lane 2: Non-transfected lysate.")
![Simple Western PKR Antibody (HL71/10) [Unconjugated]](https://images.novusbio.com/images2/PKR_MAB1980_Simple_Western_20723.jpg)
![Immunocytochemistry PKR Antibody (HL71/10) [Unconjugated]](https://images.novusbio.com/images2/PKR_MAB1980_Immunocytochemistry_9844.jpg)
![Western Blot PKR Antibody (HL71/10) [Unconjugated]](https://images.novusbio.com/images2/PKR_MAB1980_Western_Blot_20507.jpg)
![Western Blot RB1 Antibody (607121) [Unconjugated]](https://images.novusbio.com/images2/RB1_MAB6495_Western_Blot_10216.jpg)
![Immunocytochemistry RB1 Antibody (607121) [Unconjugated]](https://images.novusbio.com/images2/RB1_MAB6495_Immunocytochemistry_10464.jpg)
![Simple Western RB1 Antibody (607121) [Unconjugated]](https://images.novusbio.com/images2/RB1_MAB6495_Simple_Western_16629.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")