I am looking for an antibody of STEAP2 and find that there are 3 different STEAP2 antisera on the product list. But the information of antigen is not very clear for these products. Because STEAP2 has several isoforms, I wonder if you can clarify which isoform can be detected by each antibody. I will appreciate it if you can tell me the peptide sequence of each antigen.

Name: STEAP2 Antibody
Brand: Novus Biologicals
SKU: NBP3-14487
Price: 399 USD

Question

Accepted Answer

We have four STEAP2 antibodies and typically if the immunogen is not provided on the datasheet than it is deemed proprietary by the lab and cannot be provided. For catalog number NBP1-83100 however the immunogen is EYLASLFPDSLIVKGFNVVSAWALQLGPKD ASRQVYICSNNIQARQQVIELARQLNFIPI DLGSLSSAREIE For the other products I would have to get in touch with the lab to see if it could detect isoform 1 or 2. I can also inquire if they can provide a range it targets in if that would be useful. Typically though if it is indicated as C-terminal it will be within the last 50 amino acids. Was there a particular species or isoform you were interested in?

At	=	A. thaliana	SyHa	=	Golden Syrian Hamster
All	=	All Species	Ha	=	Hamster
An	=	Animal	Hu	=	Human
ArHa	=	Armenian Hamster	I	=	Insect
Av	=	Avian	Ll	=	Llama
Bb	=	Baboon	Ma	=	Mammal
Ba	=	Bacteria	Mk	=	Monkey
Bv	=	Bovine	Mu	=	Mouse
Ca	=	Canine	Multi	=	Multi-species
Ce	=	C. Elegans	NA	=	Non-species specific
Ch	=	Chicken	Or	=	Orangutan
ChHa	=	Chinese Hamster	Pl	=	Plant
Cm	=	Cynomolgus Monkey	Pm	=	Primate
Do	=	Donkey	Po	=	Porcine
Dr	=	Drosophilia	Rb	=	Rabbit
Ec	=	E. Coli	Rt	=	Rat
Eq	=	Equine	RM	=	Rhesus Macaque
Fe	=	Feline	Sh	=	Sheep
Ft	=	Ferret	Vb	=	Vertebrate
Fi	=	Fish	Vi	=	Virus
Fu	=	Fungi	Xp	=	Xenopus
Ge	=	Gerbil	Ye	=	Yeast
GP	=	Guinea Pig	Ze	=	Zebrafish
Gt	=	Goat

Reactivity	Hu, Mu, Bt, Bv, Ca, Eq, PmSpecies Glossary
Applications	IHC
Clonality	Polyclonal
Host	Rabbit
Conjugate	Unconjugated
Concentration	1 mg/ml

Description	Product can be stored undiluted at 4C for up to 1 month.
Immunogen	Synthetic 15 amino acid peptide from C-Terminus of human STEAP2.
Epitope	C-Terminus
Specificity	Human STEAP2. BLAST analysis of the peptide immunogen showed no homology with other human proteins.
Predicted Species	Mouse (93%), Bovine (100%), Primate (93%), Equine (93%), Bat (100%), Canine (93%). Backed by our 100% Guarantee.
Clonality	Polyclonal
Host	Rabbit
Gene	STEAP2
Purity	Immunogen affinity purified
Innovator's Reward	Test in a species/application not listed above to receive a full credit towards a future purchase. Learn about the Innovator's Reward

Storage	Keep as concentrated solution. Aliquot and store at -20C or below. Avoid multiple freeze-thaw cycles.
Buffer	PBS
Preservative	0.1% Sodium Azide
Concentration	1 mg/ml
Purity	Immunogen affinity purified

STEAP2 Antibody

Species Glossary

Images

Product Details

Order Details

STEAP2 Antibody Summary

Applications/Dilutions

Reactivity Notes

Packaging, Storage & Formulations

Alternate Names for STEAP2 Antibody

Background

Limitations

Customers Who Viewed This Item Also Viewed...

Publications for STEAP2 Antibody (NBP3-14487) (0)

Reviews for STEAP2 Antibody (NBP3-14487) (0)

Product General Protocols

FAQs for STEAP2 Antibody (NBP3-14487). (Showing 1 - 1 of 1 FAQ).

Secondary Antibodies

Isotype Controls

Additional STEAP2 Products

Blogs on STEAP2

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Review this Product

Bioinformatics

Dilutions	Immunohistochemistry Immunohistochemistry-Paraffin
Application Notes	.