![Western Blot: STEAP3/TSAP6 Antibody [NBP2-13395] - Analysis in human cell line PC-3 and human cell line SK-MEL-30.](http://images.novusbio.com/fullsize/STEAP3-TSAP6-Antibody-Western-Blot-NBP2-13395-img0007.jpg "Western Blot: STEAP3/TSAP6 Antibody [NBP2-13395] - Analysis in human cell line PC-3 and human cell line SK-MEL-30.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the amino acids: PKRTARLFPSAAQVTFQEEAVSSPEVIFVAVFREHYSSLCSLSDQLAGKILVDVSNPTEQEHLQHRE |
| Predicted Species | Mouse (93%), Rat (91%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | STEAP3 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for STEAP3/TSAP6 Antibody (NBP2-13395)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | STEAP3 |
![Immunocytochemistry/Immunofluorescence: STEAP3/TSAP6 Antibody [NBP2-13395] - Staining of human cell line U-2 OS shows localization to nucleoli & cytosol. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/STEAP3-TSAP6-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-13395-img0003.jpg "Immunocytochemistry/Immunofluorescence: STEAP3/TSAP6 Antibody [NBP2-13395] - Staining of human cell line U-2 OS shows localization to nucleoli & cytosol. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: STEAP3/TSAP6 Antibody [NBP2-13395] - Staining of human fallopian tube shows moderate membranous and cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/STEAP3-TSAP6-Antibody-Immunohistochemistry-Paraffin-NBP2-13395-img0006.jpg "Immunohistochemistry-Paraffin: STEAP3/TSAP6 Antibody [NBP2-13395] - Staining of human fallopian tube shows moderate membranous and cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: STEAP3/TSAP6 Antibody [NBP2-13395] - Staining of human liver shows strong cytoplasmic and membranous positivity in hepatocytes.](http://images.novusbio.com/fullsize/STEAP3-TSAP6-Antibody-Immunohistochemistry-Paraffin-NBP2-13395-img0001.jpg "Immunohistochemistry-Paraffin: STEAP3/TSAP6 Antibody [NBP2-13395] - Staining of human liver shows strong cytoplasmic and membranous positivity in hepatocytes.")
![Immunohistochemistry-Paraffin: STEAP3/TSAP6 Antibody [NBP2-13395] - Staining of human breast shows strong membranous and cytoplasmic positivity in glnadular cells.](http://images.novusbio.com/fullsize/STEAP3-TSAP6-Antibody-Immunohistochemistry-Paraffin-NBP2-13395-img0004.jpg "Immunohistochemistry-Paraffin: STEAP3/TSAP6 Antibody [NBP2-13395] - Staining of human breast shows strong membranous and cytoplasmic positivity in glnadular cells.")
![Immunohistochemistry-Paraffin: STEAP3/TSAP6 Antibody [NBP2-13395] - Staining of human duodenum shows moderate cytoplasmic and membranous positivity in glandular cells.](http://images.novusbio.com/fullsize/STEAP3-TSAP6-Antibody-Immunohistochemistry-Paraffin-NBP2-13395-img0005.jpg "Immunohistochemistry-Paraffin: STEAP3/TSAP6 Antibody [NBP2-13395] - Staining of human duodenum shows moderate cytoplasmic and membranous positivity in glandular cells.")
![Immunocytochemistry Caspase-3 Antibody [Unconjugated] - Active](https://images.novusbio.com/images2/Caspase-3_AF835_Immunocytochemistry_6532.jpg)
![Immunohistochemistry Caspase-3 Antibody [Unconjugated] - Active](https://images.novusbio.com/images2/Caspase3_AF835_Immunohistochemistry_22976.jpg)
![Immunocytochemistry Caspase-3 Antibody [Unconjugated] - Active](https://images.novusbio.com/images2/Caspase-3_AF835_Immunocytochemistry_9340.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")