Do you have a primary anti-DMT1 antibody against mouse for Western Blot?

Name: NRAMP2/SLC11A2/DMT1 Antibody (4C6)
Brand: Novus Biologicals
SKU: H00004891-M01
Price: 519 USD

Question

Accepted Answer

We do not currently have any antibodies that we have tested against mouse for DMT1. However, if you would try one of our DMT1 antibodies against mouse, we do have an Innovators Reward Program.

At	=	A. thaliana	SyHa	=	Golden Syrian Hamster
All	=	All Species	Ha	=	Hamster
An	=	Animal	Hu	=	Human
ArHa	=	Armenian Hamster	I	=	Insect
Av	=	Avian	Ll	=	Llama
Bb	=	Baboon	Ma	=	Mammal
Ba	=	Bacteria	Mk	=	Monkey
Bv	=	Bovine	Mu	=	Mouse
Ca	=	Canine	Multi	=	Multi-species
Ce	=	C. Elegans	NA	=	Non-species specific
Ch	=	Chicken	Or	=	Orangutan
ChHa	=	Chinese Hamster	Pl	=	Plant
Cm	=	Cynomolgus Monkey	Pm	=	Primate
Do	=	Donkey	Po	=	Porcine
Dr	=	Drosophilia	Rb	=	Rabbit
Ec	=	E. Coli	Rt	=	Rat
Eq	=	Equine	RM	=	Rhesus Macaque
Fe	=	Feline	Sh	=	Sheep
Ft	=	Ferret	Vb	=	Vertebrate
Fi	=	Fish	Vi	=	Virus
Fu	=	Fungi	Xp	=	Xenopus
Ge	=	Gerbil	Ye	=	Yeast
GP	=	Guinea Pig	Ze	=	Zebrafish
Gt	=	Goat

Reactivity	Hu, Mu, Po, BvSpecies Glossary
Applications	WB, ELISA, ICC/IF, IHC, IP
Clone	4C6
Clonality	Monoclonal
Host	Mouse
Conjugate	Unconjugated

Description	Quality control test: Antibody Reactive Against Recombinant Protein.
Immunogen	SLC11A2 (NP_000608, 1 a.a. ~ 65 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MVLGPEQKMSDDSVSGDHGESASLGNINPAYSNPSLSQSPGDSEEYFATYFNEKISIPEEEYSCF
Specificity	SLC11A2 - solute carrier family 11 (proton-coupled divalent metal ion transporters), member 2
Isotype	IgG2a Kappa
Clonality	Monoclonal
Host	Mouse
Gene	SLC11A2
Purity	IgG purified
Innovator's Reward	Test in a species/application not listed above to receive a full credit towards a future purchase. Learn about the Innovator's Reward

Storage	Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer	In 1x PBS, pH 7.4
Preservative	No Preservative
Purity	IgG purified

Publications using H00004891-M01	Applications	Species
Zhao L, Bartnikas T, Chu X et al. Hyperglycemia promotes microvillus membrane expression of DMT1 in intestinal epithelial cells in a PKCa-dependent manner. FASEB J. 2018-11-13 [PMID: 30423260] (WB, Human)	WB	Human
Raaij SV, Swelm RV, Bouman K et al. Tubular iron deposition and iron handling proteins in human healthy kidney and chronic kidney disease Sci Rep 2018-06-19 [PMID: 29921869] (IF/IHC, Human)	IF/IHC	Human
Ma W, Lu J, Jiang S et al. Maternal protein restriction depresses the duodenal expression of iron transporters and serum iron level in male weaning piglets. Br J Nutr 2017-05-23 [PMID: 28534724]
Montalbetti N, Simonin A, Simonin C et al. Discovery and characterization of a novel non-competitive inhibitor of the divalent metal transporter DMT1/SLC11A2. Biochem Pharmacol. 2015-06-02 [PMID: 26047847]
Montalbetti N, Simonin A, Dalghi MG et al. Development and Validation of a Fast and Homogeneous Cell-Based Fluorescence Screening Assay for Divalent Metal Transporter 1 (DMT1/SLC11A2) Using the FLIPR Tetra. J Biomol Screen. 2014-02-06 [PMID: 24505080]
Hansen SL, Trakooljul N, Liu HC et al. Proteins involved in iron metabolism in beef cattle are affected by copper deficiency in combination with high dietary manganese, but not by copper deficiency alone J Anim Sci 2010-01-01 [PMID: 19820055] (WB, Bovine)	WB	Bovine
Howitt J, Putz U, Lackovic J et al. Divalent metal transporter 1 (DMT1) regulation by Ndfip1 prevents metal toxicity in human neurons. Proc Natl Acad Sci U S A. 2009-08-25 [PMID: 19706893]
Barth S, Edlich F, Berchner-Pfannschmidt U et al. Hypoxia-inducible Factor Prolyl-4-hydroxylase PHD2 Protein Abundance Depends on Integral Membrane Anchoring of FKBP38. J Biol Chem;284(34):23046-23058. 2009-01-01 [PMID: 19546213]
Foot NJ, Dalton HE, Shearwin-Whyatt LM et al. Regulation of the divalent metal ion transporter DMT1 iron homeostasis by a ubiquitin-dependent mechanism involving Ndfips WWP2. Blood;112(10):4268-75. 2008-11-15 [PMID: 18776082]

NRAMP2/SLC11A2/DMT1 Antibody (4C6)

Species Glossary

Images

Product Details

Order Details

NRAMP2/SLC11A2/DMT1 Antibody (4C6) Summary

Applications/Dilutions

Reactivity Notes

Packaging, Storage & Formulations

Notes

Alternate Names for NRAMP2/SLC11A2/DMT1 Antibody (4C6)

Background

Limitations

Customers Who Viewed This Item Also Viewed...

Publications for NRAMP2/SLC11A2/DMT1 Antibody (H00004891-M01)(9)

Reviews for NRAMP2/SLC11A2/DMT1 Antibody (H00004891-M01) (0)

Product General Protocols

Video Protocols

FAQs for NRAMP2/SLC11A2/DMT1 Antibody (H00004891-M01). (Showing 1 - 1 of 1 FAQs).

Secondary Antibodies

Isotype Controls

Additional NRAMP2/SLC11A2/DMT1 Products

Blogs on NRAMP2/SLC11A2/DMT1

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Review this Product

Bioinformatics

Gene Symbol	SLC11A2
Entrez	4891(Human)
OMIM	206(Human)
Uniprot	NP_000608(Human)