![Western Blot: SPOP Antibody [H00008405-B01P] - SPOP inhibits gastric cancer cell proliferation and migration. The expression of SPOP protein in human GC cell lines - MKN45, MKN28, AGS, SGC7901, and human gastric mucosal cell line GES-1 by Western blotting. Image collected and cropped by CiteAb from the following publication (www.jeccr.biomedcentral.com/articles/10.1186/s13046-014-0075-8) licensed under a CC-BY license.](http://images.novusbio.com/fullsize/SPOP-Antibody-Western-Blot-H00008405-B01P-img0007.jpg "Western Blot: SPOP Antibody [H00008405-B01P] - SPOP inhibits gastric cancer cell proliferation and migration. The expression of SPOP protein in human GC cell lines - MKN45, MKN28, AGS, SGC7901, and human gastric mucosal cell line GES-1 by Western blotting. Image collected and cropped by CiteAb from the following publication (www.jeccr.biomedcentral.com/articles/10.1186/s13046-014-0075-8) licensed under a CC-BY license.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ICC/IF, IHC, KD |
| Clonality | Polyclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Description | Quality control test: Antibody reactive against mammalian transfected lysate. |
| Immunogen | SPOP (NP_001007227.1, 1 a.a. - 374 a.a.) full-length human protein. MSRVPSPPPPAEMSSGPVAESWCYTQIKVVKFSYMWTINNFSFCREEMGEVIKSSTFSSGANDKLKWCLRVNPKGLDEESKDYLSLYLLLVSCPKSEVRAKFKFSILNAKGEETKAMESQRAYRFVQGKDWGFKKFIRRDFLLDEANGLLPDDKLTLFCEVSVVQDSVNISGQNTMNMVKVPECRLADELGGLWENSRFTDCCLCVAGQEFQAHKAILAARSPVFSAMFEHEMEESKKNRVEINDVEPEVFKEMMCFIYTGKAPNLDKMADDLLAAADKYALERLKVMCEDALCSNLSVENAAEILILADLHSADQLKTQAVDFINYHASDVLETSGWKSMVVSHPHLVAEAYRSLASAQCPFLGPPRKRLKQS |
| Specificity | SPOP - speckle-type POZ protein, |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Mouse |
| Gene | SPOP |
| Purity | Protein A purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Application Notes | Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control. It has been used for IF. Use in Immunohistochemistry-paraffin reported in scientific literature (PMID: 24912477). |
|
| Publications |
|
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.4) |
| Preservative | No Preservative |
| Purity | Protein A purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | SPOP |
| Entrez |
|
| Uniprot |
|
![Immunocytochemistry/Immunofluorescence: SPOP Antibody [H00008405-B01P] - Analysis of purified antibody to SPOP on HeLa cell. (antibody concentration 10 ug/ml)](http://images.novusbio.com/fullsize/SPOP-Antibody-Immunocytochemistry-Immunofluorescence-H00008405-B01P-img0003.jpg "Immunocytochemistry/Immunofluorescence: SPOP Antibody [H00008405-B01P] - Analysis of purified antibody to SPOP on HeLa cell. (antibody concentration 10 ug/ml)")
![Western Blot: SPOP Antibody [H00008405-B01P] - Analysis of SPOP expression in transfected 293T cell line by SPOP polyclonal antibody. Lane 1: SPOP transfected lysate(41.14 KDa). Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/SPOP-Antibody-Western-Blot-H00008405-B01P-img0004.jpg "Western Blot: SPOP Antibody [H00008405-B01P] - Analysis of SPOP expression in transfected 293T cell line by SPOP polyclonal antibody. Lane 1: SPOP transfected lysate(41.14 KDa). Lane 2: Non-transfected lysate.")
![Western Blot: SPOP Antibody [H00008405-B01P] - SPOP expression in gastric cancer. Representative immunoblotting of SPOP protein in gastric cancer samples. Image collected and cropped by CiteAb from the following publication (www.jeccr.biomedcentral.com/articles/10.1186/s13046-014-0075-8) licensed under a CC-BY license.](http://images.novusbio.com/fullsize/SPOP-Antibody-Western-Blot-H00008405-B01P-img0005.jpg "Western Blot: SPOP Antibody [H00008405-B01P] - SPOP expression in gastric cancer. Representative immunoblotting of SPOP protein in gastric cancer samples. Image collected and cropped by CiteAb from the following publication (www.jeccr.biomedcentral.com/articles/10.1186/s13046-014-0075-8) licensed under a CC-BY license.")
![Knockdown Validated: SPOP Antibody [H00008405-B01P] - SPOP inhibits Hh/Gli signaling activity. SPOP promotes Gli2 degradation through proteasome pathway. MKN45 cells were treated with vehicle (DMSO) or miR-SPOP for 48 h, with or without 10 mM MG-132. In order to limit toxicity, MG-132 was added 4 h before cell harvest. Lysates were subjected to immunoblotting with indicated antibodies. Image collected and cropped by CiteAb from the following publication (www.jeccr.biomedcentral.com/articles/10.1186/s13046-014-0075-8) licensed under a CC-BY license.](http://images.novusbio.com/fullsize/SPOP-Antibody-Knockdown-Validated-H00008405-B01P-img0006.jpg "Knockdown Validated: SPOP Antibody [H00008405-B01P] - SPOP inhibits Hh/Gli signaling activity. SPOP promotes Gli2 degradation through proteasome pathway. MKN45 cells were treated with vehicle (DMSO) or miR-SPOP for 48 h, with or without 10 mM MG-132. In order to limit toxicity, MG-132 was added 4 h before cell harvest. Lysates were subjected to immunoblotting with indicated antibodies. Image collected and cropped by CiteAb from the following publication (www.jeccr.biomedcentral.com/articles/10.1186/s13046-014-0075-8) licensed under a CC-BY license.")
![Western Blot: SPOP Antibody [H00008405-B01P] - SPOP inhibits gastric cancer cell proliferation & migration. (A) The expression of SPOP protein in human GC cell lines - MKN45, MKN28, AGS, SGC7901, & human gastric mucosal cell line GES-1 by Western blotting. (B) Detection of SPOP expression in transfected AGS cells. Expression of SPOP was detected in cell lysates of SPOP-V5 transfected AGS cells by Western blotting. Control, AGS cells with empty vector plasmid; #1 & #2 represent different groups of stable AGS cell lines transfected with SPOP. (C) Decreased viability of gastric cancer cells transfected with SPOP. The viability of AGS cells was assessed by using an MTT assay. Data represent the average of three experiments (mean ± SD). **P 50 cells. G, histograms show the rate of colony formation. Data represent the average of three experiments (mean ± SD). **P 50 cells. (G) Histograms show the colony formation rate. Data represent the average of three experiments (mean ± SD). **P 50 cells. G, histograms show the rate of colony formation. Data represent the average of three experiments (mean ± SD). **P < 0.01, compared to DMSO treated cells. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/25204354), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/h00008405-b01p_mouse-polyclonal-spop-antibody-310202415485126.jpg "Western Blot: SPOP Antibody [H00008405-B01P] - SPOP inhibits gastric cancer cell proliferation & migration. (A) The expression of SPOP protein in human GC cell lines - MKN45, MKN28, AGS, SGC7901, & human gastric mucosal cell line GES-1 by Western blotting. (B) Detection of SPOP expression in transfected AGS cells. Expression of SPOP was detected in cell lysates of SPOP-V5 transfected AGS cells by Western blotting. Control, AGS cells with empty vector plasmid; #1 & #2 represent different groups of stable AGS cell lines transfected with SPOP. (C) Decreased viability of gastric cancer cells transfected with SPOP. The viability of AGS cells was assessed by using an MTT assay. Data represent the average of three experiments (mean ± SD). **P 50 cells. G, histograms show the rate of colony formation. Data represent the average of three experiments (mean ± SD). **P 50 cells. (G) Histograms show the colony formation rate. Data represent the average of three experiments (mean ± SD). **P 50 cells. G, histograms show the rate of colony formation. Data represent the average of three experiments (mean ± SD). **P < 0.01, compared to DMSO treated cells. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/25204354), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![Western Blot: SPOP Antibody [H00008405-B01P] - SPOP promotes tumor cell apoptosis. (A) Overexpression of SPOP upregulates the expression of apoptotic proteins. MKN45 cells were transfected with Myc-SPOP & incubated for 48 h. Target proteins in cell lysates were detected by indicated antibodies using Western blotting. (B) Repression of SPOP inhibits cancer cell apoptosis. MKN45 cells were transfected with miR-SPOP-1430 & incubated for 48 h. Target proteins in cell lysates were probed with indicated antibodies using Western blotting. (C) Overexpressed SPOP promotes cleaved Caspase-3 expression. AGS cells were transfected with Myc-SPOP for 48 h & then fixed. Myc-SPOP was detected by incubating cells with mouse anti-Myc antibody & subsequently Alexa Fluor 488 goat anti-mouse antibody. Cleaved Caspase-3 was detected by incubating cells with rabbit anti-cleaved Caspase-3 & subsequently Alexa Fluor 594 donkey anti-rabbit antibody. Nucleus was identified by DAPI staining. (D) The representative photos of cleaved Caspase-3 expression in gastric cancer tissues & adjacent gastric tissues by using immunohistochemical staining (DAB staining, scale bar, 100 μm). Magnified local images reflecting detailed information were shown on the bottom. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/25204354), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/h00008405-b01p_mouse-polyclonal-spop-antibody-310202415483629.jpg "Western Blot: SPOP Antibody [H00008405-B01P] - SPOP promotes tumor cell apoptosis. (A) Overexpression of SPOP upregulates the expression of apoptotic proteins. MKN45 cells were transfected with Myc-SPOP & incubated for 48 h. Target proteins in cell lysates were detected by indicated antibodies using Western blotting. (B) Repression of SPOP inhibits cancer cell apoptosis. MKN45 cells were transfected with miR-SPOP-1430 & incubated for 48 h. Target proteins in cell lysates were probed with indicated antibodies using Western blotting. (C) Overexpressed SPOP promotes cleaved Caspase-3 expression. AGS cells were transfected with Myc-SPOP for 48 h & then fixed. Myc-SPOP was detected by incubating cells with mouse anti-Myc antibody & subsequently Alexa Fluor 488 goat anti-mouse antibody. Cleaved Caspase-3 was detected by incubating cells with rabbit anti-cleaved Caspase-3 & subsequently Alexa Fluor 594 donkey anti-rabbit antibody. Nucleus was identified by DAPI staining. (D) The representative photos of cleaved Caspase-3 expression in gastric cancer tissues & adjacent gastric tissues by using immunohistochemical staining (DAB staining, scale bar, 100 μm). Magnified local images reflecting detailed information were shown on the bottom. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/25204354), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![Western Blot Rap1A/B Antibody [Unconjugated]](https://images.novusbio.com/images2/Rap1B_AF3767_Western_Blot_5331.jpg)
![Western Blot Rap1A/B Antibody [Unconjugated]](https://images.novusbio.com/images2/Rap1B_AF3767_Western_Blot_6316.jpg)
![Immunohistochemistry Rap1A/B Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af3767_human-mouse-rat-rap1a-b-affinity-purified-polyclonal-ab-immunohistochemistry-318202392533..jpg)
![Flow Cytometry: Mouse IgG Isotype Control [NBP1-97019]](https://images.novusbio.com/images/Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP1-97019-img0004.jpg "Flow Cytometry: Mouse IgG Isotype Control [NBP1-97019]")