![Western Blot: SMURF2 Antibody [NBP2-57554] - Analysis in human cell line U-251 MG.](http://images.novusbio.com/fullsize/SMURF2-Antibody-Western-Blot-NBP2-57554-img0008.jpg "Western Blot: SMURF2 Antibody [NBP2-57554] - Analysis in human cell line U-251 MG.")
| Reactivity | Hu, Rt, MuSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LSCFVDENTPISGTNGATCGQSSDPRLAERRVRSQRHRNYMSRTHLHTPPD |
| Predicted Species | Mouse (96%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | SMURF2 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
| Publication using NBP2-57554 | Applications | Species |
|---|---|---|
| Gordeeva O, Gordeev A, Khaydukov S TRAF4 positively regulates the osteogenic differentiation of mesenchymal stem cells by acting as an E3 ubiquitin ligase to degrade Smurf2 Cell Death Differ. 2019-05-10 [PMID: 31076633] (IHC-P, Human, Rat) | IHC-P | Human, Rat |
Secondary Antibodies |
Isotype Controls |
Research Areas for SMURF2 Antibody (NBP2-57554)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | SMURF2 |
![Immunocytochemistry/Immunofluorescence: SMURF2 Antibody [NBP2-57554] - Staining of human cell line BJ shows localization to nuclear speckles. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/SMURF2-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-57554-img0001.jpg "Immunocytochemistry/Immunofluorescence: SMURF2 Antibody [NBP2-57554] - Staining of human cell line BJ shows localization to nuclear speckles. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: SMURF2 Antibody [NBP2-57554] - Staining of human skeletal muscle shows no positivity in myocytes as expected.](http://images.novusbio.com/fullsize/SMURF2-Antibody-Immunohistochemistry-Paraffin-NBP2-57554-img0007.jpg "Immunohistochemistry-Paraffin: SMURF2 Antibody [NBP2-57554] - Staining of human skeletal muscle shows no positivity in myocytes as expected.")
![Immunohistochemistry-Paraffin: SMURF2 Antibody [NBP2-57554] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts.](http://images.novusbio.com/fullsize/SMURF2-Antibody-Immunohistochemistry-Paraffin-NBP2-57554-img0004.jpg "Immunohistochemistry-Paraffin: SMURF2 Antibody [NBP2-57554] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts.")
![Immunohistochemistry-Paraffin: SMURF2 Antibody [NBP2-57554] - Staining of human placenta shows moderate cytoplasmic positivity in trophoblastic cells.](http://images.novusbio.com/fullsize/SMURF2-Antibody-Immunohistochemistry-Paraffin-NBP2-57554-img0005.jpg "Immunohistochemistry-Paraffin: SMURF2 Antibody [NBP2-57554] - Staining of human placenta shows moderate cytoplasmic positivity in trophoblastic cells.")
![Immunohistochemistry-Paraffin: SMURF2 Antibody [NBP2-57554] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.](http://images.novusbio.com/fullsize/SMURF2-Antibody-Immunohistochemistry-Paraffin-NBP2-57554-img0006.jpg "Immunohistochemistry-Paraffin: SMURF2 Antibody [NBP2-57554] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.")
![Western Blot Smad7 Antibody (293039) [Unconjugated]](https://images.novusbio.com/images2/Smad7_MAB2029_Western_Blot_6004.jpg)
![Immunohistochemistry Smad7 Antibody (293039) [Unconjugated]](https://images.novusbio.com/images2/Smad7_MAB2029_Immunohistochemistry_6962.jpg)
![Immunohistochemistry Smad7 Antibody (293039) [Unconjugated]](https://images.novusbio.com/images2/Smad7_MAB2029_Immunohistochemistry_9846.jpg)
![Western Blot Smad2/3 Antibody [Unconjugated]](https://images.novusbio.com/images2/Smad3_AF3797_Western_Blot_5347.jpg)
![Chromatin Immunoprecipitation (ChIP) Smad2/3 Antibody [Unconjugated]](https://images.novusbio.com/images2/Smad3_AF3797_Chromatin_Immunoprecipitation_11240.jpg)
![Immunocytochemistry Smad2/3 Antibody [Unconjugated]](https://images.novusbio.com/images2/Smad3_AF3797_Immunocytochemistry_11829.jpg)
![Western Blot TGF-beta RI/ALK-5 Antibody [Unconjugated]](https://images.novusbio.com/images2/TGFbeta_RI_AF3025_Western_Blot_17081.jpg)
![Immunocytochemistry TGF-beta RI/ALK-5 Antibody [Unconjugated]](https://images.novusbio.com/images2/TGF-beta_RI_AF3025_Immunocytochemistry_9948.jpg)
![Western Blot TGF-beta RI/ALK-5 Antibody [Unconjugated]](https://images.novusbio.com/images/af3025_human-tgf-beta-ri-alk-5-affinity-purified-polyclonal-ab-41202412402510.jpg)
![Bioactivity TGF-beta 1 [Unconjugated]](https://images.novusbio.com/images/protein/7754-bhcf_recombinant-human-tgf-beta-1-human-cell-expressed-cf-bioactivity-1811202013946.jpg)
![Chromatin Immunoprecipitation (ChIP) Smad4 Antibody [Unconjugated]](https://images.novusbio.com/images2/Smad4_AF2097_Chromatin_Immunoprecipitation_11225.jpg)
![Western Blot Smad4 Antibody [Unconjugated]](https://images.novusbio.com/images2/Smad4_AF2097_Western_Blot_17168.jpg)
![Immunocytochemistry Smad4 Antibody [Unconjugated]](https://images.novusbio.com/images2/Smad4_AF2097_Immunocytochemistry__Immunofluorescence_17807.jpg)
![Immunohistochemistry Smad1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Smad1_AF2039_Immunohistochemistry_10106.jpg)
![Western Blot Smad1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Smad1_AF2039_Western_Blot_5162.jpg)
![Simple Western Smad1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Smad1_AF2039_Simple_Western_16677.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")