Home » SMURF1 » SMURF1 Proteins » SMURF1 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

SMURF1 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for SMURF1 Recombinant Protein Antigen (NBP3-17934PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

SMURF1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SMURF1

Source: E. coli

Amino Acid Sequence: RGLLENEGTVYEDSGPGRPLSCFMEEPAPYTDSTGAAAGGGNCRFVESPSQDQRLQAQRLRNPDVRGSLQTPQNRPHG

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SMURF1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-17934.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for SMURF1 Recombinant Protein Antigen

  • E3 ubiquitin ligase SMURF1
  • EC 6.3.2
  • EC 6.3.2.-
  • hSMURF1
  • KIAA1625
  • KIAA1625E3 ubiquitin-protein ligase SMURF1
  • SMAD specific E3 ubiquitin protein ligase 1
  • SMAD ubiquitination regulatory factor 1
  • Smad-specific E3 ubiquitin ligase 1
  • SMAD-specific E3 ubiquitin-protein ligase 1
  • SMURF1

Background

SMURF1 encodes a ubiquitin ligase that is specific for receptor-regulated SMAD proteins in the bone morphogenetic protein (BMP) pathway. A similar protein in Xenopus is involved in embryonic pattern formation. Alternative splicing results in multiple transcript variants encoding different isoforms. An additional transcript variant has been identified, but its full length sequence has not been determined.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

SMURF2 Antibody -
BSA Free
NBP2-81916
Western Blot SMURF2 Antibody - BSA Free
Immunohistochemistry SMURF2 Antibody - BSA Free
Immunohistochemistry SMURF2 Antibody - BSA Free
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
GARS Antibody
NBP3-35329
GARS Antibody
Species: Hu, Mu
Applications: ELISA, ICC/IF, WB
Smad1 Antibody
[Unconjugated]
AF2039
Immunohistochemistry Smad1 Antibody [Unconjugated]
Western Blot Smad1 Antibody [Unconjugated]
Simple Western Smad1 Antibody [Unconjugated]
(8 Publications)
Species: Hu
Applications: IHC, Simple Western, WB
RhoA Antibody
NB100-91273
Immunocytochemistry/ Immunofluorescence RhoA Antibody
Immunohistochemistry-Paraffin RhoA Antibody
Immunocytochemistry/ Immunofluorescence RhoA Antibody
(1 Review)
(5 Publications)
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Smad7 Antibody
(293039) [Unconjugate
MAB2029
Western Blot Smad7 Antibody (293039) [Unconjugated]
Immunohistochemistry Smad7 Antibody (293039) [Unconjugated]
Immunohistochemistry Smad7 Antibody (293039) [Unconjugated]
(1 Review)
(59 Publications)
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
ALDH9A1 Antibody
NBP1-89150
Western Blot ALDH9A1 Antibody
Western Blot ALDH9A1 Antibody
Immunohistochemistry-Paraffin ALDH9A1 Antibody
(3 Publications)
Species: Hu, Rt
Applications: IHC, IHC-P, WB
ILT6/CD85e/LILRA3
Antibody (2E9)
H00011026-M01
Western Blot ILT6/CD85e/LILRA3 Antibody (2E9)
(6 Publications)
Species: Hu
Applications: ELISA, WB
Dihydrolipoamide
Dehydrogenase/DLD Ant ...
NBP1-31302
Immunocytochemistry/ Immunofluorescence Dihydrolipoamide Dehydrogenase/DLD Antibody
Western Blot Dihydrolipoamide Dehydrogenase/DLD Antibody
Western Blot Dihydrolipoamide Dehydrogenase/DLD Antibody
(1 Review)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
ZNF645 Antibody
NBP2-21037
Western Blot ZNF645 Antibody
Immunohistochemistry-Paraffin ZNF645 Antibody
Species: Hu
Applications: IHC, IHC-P, WB
MUL1 Antibody
(5H6.2D5) - BSA Free
NBP2-31361
Western Blot MUL1 Antibody (5H6.2D5) - BSA Free
Immunohistochemistry-Paraffin MUL1 Antibody (5H6.2D5) - BSA Free
Immunohistochemistry-Paraffin MUL1 Antibody (5H6.2D5) - BSA Free
Species: Hu
Applications: IHC, IHC-P, WB
TRIM50 Antibody
NBP1-81988
Immunohistochemistry-Paraffin TRIM50 Antibody
Species: Hu
Applications: IHC, IHC-P
BMP-2
[Unconjugated]
355-BM
Bioactivity BMP-2 [Unconjugated]
(190 Publications)
Species: Hu, Mu, Rt
Applications: BA
Smad2/3 Antibody
[Unconjugated]
AF3797
Western Blot Smad2/3 Antibody [Unconjugated]
Chromatin Immunoprecipitation (ChIP) Smad2/3 Antibody [Unconjugated]
Immunocytochemistry Smad2/3 Antibody [Unconjugated]
(1 Review)
(24 Publications)
Species: Hu, Mu
Applications: ChIP, ICC, IHC, Simple Western, WB
RUNX2/CBFA1
Antibody (232902) [Un ...
MAB2006
Immunocytochemistry RUNX2/CBFA1 Antibody (232902) [Unconjugated]
(1 Review)
(28 Publications)
Species: Hu
Applications: ICC
TGF-beta RI/ALK-5
Antibody [Unconjugate ...
AF3025
Western Blot TGF-beta RI/ALK-5 Antibody [Unconjugated]
Immunocytochemistry TGF-beta RI/ALK-5 Antibody [Unconjugated]
Western Blot TGF-beta RI/ALK-5 Antibody [Unconjugated]
(16 Publications)
Species: Hu
Applications: ELISA, ICC, WB
SMAD6 Antibody
NB100-56440
Immunohistochemistry-Paraffin SMAD6 Antibody
Western Blot SMAD6 Antibody
Simple Western SMAD6 Antibody
(2 Reviews)
(10 Publications)
Species: Hu, Pm, Mu, Pm, Rt, Sh
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
Smad4 Antibody
[Unconjugated]
AF2097
Chromatin Immunoprecipitation (ChIP) Smad4 Antibody [Unconjugated]
Western Blot Smad4 Antibody [Unconjugated]
Immunocytochemistry Smad4 Antibody [Unconjugated]
(9 Publications)
Species: Hu
Applications: ChIP, ICC, WB
Smad3 Antibody
NB100-56479
Immunocytochemistry/ Immunofluorescence Smad3 Antibody
Western Blot Smad3 Antibody
Immunohistochemistry-Paraffin Smad3 Antibody
(5 Reviews)
(8 Publications)
Species: Bv, Ca, Hu, Mu, Po, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
TGF-beta 1
[Unconjugated]
7754-BH/CF
Bioactivity TGF-beta 1 [Unconjugated]
(53 Publications)
Species: Hu
Applications: BA
SMURF1 Recombinant
Protein Antigen
NBP3-17934PEP
SMURF1 Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for SMURF1 Recombinant Protein Antigen (NBP3-17934PEP) (0)

There are no publications for SMURF1 Recombinant Protein Antigen (NBP3-17934PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SMURF1 Recombinant Protein Antigen (NBP3-17934PEP) (0)

There are no reviews for SMURF1 Recombinant Protein Antigen (NBP3-17934PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for SMURF1 Recombinant Protein Antigen (NBP3-17934PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SMURF1 Products

Research Areas for SMURF1 Recombinant Protein Antigen (NBP3-17934PEP)

Find related products by research area.

Blogs on SMURF1

There are no specific blogs for SMURF1, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our SMURF1 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol SMURF1