SMAD6 Recombinant Protein Antigen Summary
Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SMAD6. Source: E. coli Amino Acid Sequence: PRPMSEPGAGAGSSLLDVAEPGGPGWLPESDCETVTCCLF Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
Source |
E. coli |
Protein/Peptide Type |
Recombinant Protein Antigen |
Gene |
SMAD6 |
Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
Dilutions |
- Antibody Competition 10 - 100 molar excess
|
Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-56758. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
Theoretical MW |
22 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
Storage |
Store at -20C. Avoid freeze-thaw cycles. |
Buffer |
PBS and 1M Urea, pH 7.4. |
Preservative |
No Preservative |
Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for SMAD6 Recombinant Protein Antigen
Background
SMADs are members of the MAD-related family of molecules. MAD-related proteins are a family of intracellular proteins that are essential components in the signaling pathways of the serine/threonine kinase receptors of the transforming growth factor beta superfamily (1). SMADs can be divided into receptor-regulated SMADs (R-SMADs: SMAD1, SMAD2, SMAD5, SMAD8 and SMAD9), common-mediator SMAD (co-SMAD: SMAD4), and inhibitory SMADs (I-SMADs: SMAD6 and SMAD7). SMAD1, SMAD5, SMAD8 and SMAD9 have high degrees of homology and antibodies are available that recognize sequences common to all of them. SMAD8 and SMAD9 are typically used as alternate names for one another in the literature. Human SMAD1 is a 465 amino acid protein; GenBank Accession No. AAP36050.1. Human SMAD2 is a 467 amino acid protein; GenBank Accession No. AAC51918.1 Human SMAD3 is a 425 amino acid protein; GenBank Accession No. NP_005893.1 Human SMAD4 is a 552 amino acid protein GenBank Accession No. NP_005350.1. Human SMAD5 is a 465 amino acid protein; GenBank Accession No. AAC50791.1. Human SMAD6 is a 496 amino acid protein; GenBank Accession No. AAH12986.1 Human SMAD7 is a 426 amino acid protein; GenBank Accession No. AAB81354.1 Mouse SMAD8 is a 430 amino acid protein; GenBank Accession No. AAN85445.1 Human SMAD9 is a 430 amino acid protein; GenBank Accession No. NP_005896.1
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 3 months from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
Species: Hu
Applications: IHC, Simple Western, WB
Species: Hu, Mu
Applications: ELISA, ICC/IF, WB
Species: Hu, Mu, Rt
Applications: BA
Species: Hu, Mu
Applications: ChIP, ICC, IHC, Simple Western, WB
Species: Hu
Applications: ChIP, ICC, WB
Species: Hu
Applications: BA, BA
Species: Bv, Ca, Hu, Mu, Po, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: BA
Species: Hu
Applications: ELISA, ICC, WB
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Species: Hu, Mu
Applications: ICC, IHC
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC, Simple Western, WB
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Hu
Applications: AC
Publications for SMAD6 Recombinant Protein Antigen (NBP2-56758PEP) (0)
There are no publications for SMAD6 Recombinant Protein Antigen (NBP2-56758PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for SMAD6 Recombinant Protein Antigen (NBP2-56758PEP) (0)
There are no reviews for SMAD6 Recombinant Protein Antigen (NBP2-56758PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for SMAD6 Recombinant Protein Antigen (NBP2-56758PEP) (0)
Additional SMAD6 Products
Research Areas for SMAD6 Recombinant Protein Antigen (NBP2-56758PEP)
Find related products by research area.
|
Blogs on SMAD6