![Immunohistochemistry-Paraffin: SLC6A19 Antibody [NBP2-48784] - Analysis in human small intestine and pancreas tissues using NBP2-48784 antibody. Corresponding SLC6A19 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/SLC6A19-Antibody-Immunohistochemistry-Paraffin-NBP2-48784-img0007.jpg "Immunohistochemistry-Paraffin: SLC6A19 Antibody [NBP2-48784] - Analysis in human small intestine and pancreas tissues using NBP2-48784 antibody. Corresponding SLC6A19 RNA-seq data are presented for the same tissues.")
| Reactivity | HuSpecies Glossary |
| Applications | ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: MVRLVLPNPGLDARIPSLAELETIEQEEASSRPKWDNK |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | SLC6A19 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation/Permeabilization: PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Simple Western ACE-2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ACE2_AF933_Simple_Western_18669.jpg)
![Immunohistochemistry ACE-2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ACE-2_AF933_Immunohistochemistry_9800.jpg)
![Immunohistochemistry ACE-2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ACE-2_AF933_Immunohistochemistry_10025.jpg)
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | SLC6A19 |
![Immunocytochemistry/Immunofluorescence: SLC6A19 Antibody [NBP2-48784] - Staining of human cell line HEL shows localization to nucleoli. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/SLC6A19-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-48784-img0006.jpg "Immunocytochemistry/Immunofluorescence: SLC6A19 Antibody [NBP2-48784] - Staining of human cell line HEL shows localization to nucleoli. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: SLC6A19 Antibody [NBP2-48784] - Staining of human pancreas shows no membranous positivity in exocrine glanular cells as expected.](http://images.novusbio.com/fullsize/SLC6A19-Antibody-Immunohistochemistry-Paraffin-NBP2-48784-img0014.jpg "Immunohistochemistry-Paraffin: SLC6A19 Antibody [NBP2-48784] - Staining of human pancreas shows no membranous positivity in exocrine glanular cells as expected.")
![Immunohistochemistry-Paraffin: SLC6A19 Antibody [NBP2-48784] - Staining of human small intestine shows strong positivity in apical membrane in glandular cells.](http://images.novusbio.com/fullsize/SLC6A19-Antibody-Immunohistochemistry-Paraffin-NBP2-48784-img0009.jpg "Immunohistochemistry-Paraffin: SLC6A19 Antibody [NBP2-48784] - Staining of human small intestine shows strong positivity in apical membrane in glandular cells.")
![Immunohistochemistry-Paraffin: SLC6A19 Antibody [NBP2-48784] - Staining of human gallbladder shows strong positivity in apical membrane in glandular cells.](http://images.novusbio.com/fullsize/SLC6A19-Antibody-Immunohistochemistry-Paraffin-NBP2-48784-img0010.jpg "Immunohistochemistry-Paraffin: SLC6A19 Antibody [NBP2-48784] - Staining of human gallbladder shows strong positivity in apical membrane in glandular cells.")
![Immunohistochemistry-Paraffin: SLC6A19 Antibody [NBP2-48784] - Staining of human duodenum shows strong positivity in apical membrane in glandular cells.](http://images.novusbio.com/fullsize/SLC6A19-Antibody-Immunohistochemistry-Paraffin-NBP2-48784-img0011.jpg "Immunohistochemistry-Paraffin: SLC6A19 Antibody [NBP2-48784] - Staining of human duodenum shows strong positivity in apical membrane in glandular cells.")
![Immunohistochemistry-Paraffin: SLC6A19 Antibody [NBP2-48784] - Staining of human kidney shows strong membranous positivity in cells in tubules.](http://images.novusbio.com/fullsize/SLC6A19-Antibody-Immunohistochemistry-Paraffin-NBP2-48784-img0012.jpg "Immunohistochemistry-Paraffin: SLC6A19 Antibody [NBP2-48784] - Staining of human kidney shows strong membranous positivity in cells in tubules.")
![Immunohistochemistry-Paraffin: SLC6A19 Antibody [NBP2-48784] - Staining of human stomach shows no membranous positivity in glandular cells as expected.](http://images.novusbio.com/fullsize/SLC6A19-Antibody-Immunohistochemistry-Paraffin-NBP2-48784-img0013.jpg "Immunohistochemistry-Paraffin: SLC6A19 Antibody [NBP2-48784] - Staining of human stomach shows no membranous positivity in glandular cells as expected.")
![Western Blot Collectrin/TMEM27 Antibody [Unconjugated]](https://images.novusbio.com/images2/Collectrin_AF4965_Western_Blot_5589.jpg)
![Immunohistochemistry Collectrin/TMEM27 Antibody [Unconjugated]](https://images.novusbio.com/images2/Collectrin_AF4965_Immunohistochemistry_11966.jpg)
![Simple Western Collectrin/TMEM27 Antibody [Unconjugated]](https://images.novusbio.com/images2/Collectrin_AF4965_Simple_Western_17518.jpg)
![Immunocytochemistry Aminopeptidase N/CD13 Antibody [Unconjugated]](https://images.novusbio.com/images2/Aminopeptidase_N_AF2335_Immunocytochemistry__Immunofluorescence_17382.jpg)
![Immunohistochemistry Aminopeptidase N/CD13 Antibody [Unconjugated]](https://images.novusbio.com/images2/Aminopeptidase_N_AF2335_Immunohistochemistry_23316.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")