![Immunohistochemistry-Paraffin: SLC1A5 Antibody [NBP1-89327] - Staining in human prostate and skeletal muscle tissues . Corresponding SLC1A5 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/SLC1A5-Antibody-Immunohistochemistry-Paraffin-NBP1-89327-img0011.jpg "Immunohistochemistry-Paraffin: SLC1A5 Antibody [NBP1-89327] - Staining in human prostate and skeletal muscle tissues . Corresponding SLC1A5 RNA-seq data are presented for the same tissues.")
| Reactivity | Hu, Mu, PoSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: VDRTESRSTEPELIQVKSELPLDPLPVPTEEGNPLLKHYRGPAGDATVASEKESVM |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | SLC1A5 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Reviewed Applications |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Images | Ratings | Applications | Species | Date | Details | ||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
Enlarge |
reviewed by:
Verified Customer |
IHC | Human | 07/11/2017 |
Summary
|
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Western Blot: SLC1A5 Antibody [NBP1-89327] - Analysis in human cell line NB4.](http://images.novusbio.com/fullsize/SLC1A5-Antibody-Western-Blot-NBP1-89327-img0013.jpg "Western Blot: SLC1A5 Antibody [NBP1-89327] - Analysis in human cell line NB4.")
![Immunocytochemistry/Immunofluorescence: SLC1A5 Antibody [NBP1-89327] - Staining of human cell line A-431 shows localization to plasma membrane. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/SLC1A5-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-89327-img0005.jpg "Immunocytochemistry/Immunofluorescence: SLC1A5 Antibody [NBP1-89327] - Staining of human cell line A-431 shows localization to plasma membrane. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: SLC1A5 Antibody [NBP1-89327] - Staining in human hepatocellular carcinoma. Image from a verified customer review.](http://images.novusbio.com/fullsize/SLC1A5-Antibody-Immunohistochemistry-Paraffin-NBP1-89327-img0014.jpg "Immunohistochemistry-Paraffin: SLC1A5 Antibody [NBP1-89327] - Staining in human hepatocellular carcinoma. Image from a verified customer review.")
![Western Blot: SLC1A5 Antibody [NBP1-89327] - Analysis in control (vector only transfected HEK293T lysate) and SLC1A5 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).](http://images.novusbio.com/fullsize/SLC1A5-Antibody-Western-Blot-NBP1-89327-img0012.jpg "Western Blot: SLC1A5 Antibody [NBP1-89327] - Analysis in control (vector only transfected HEK293T lysate) and SLC1A5 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).")
![Immunohistochemistry-Paraffin: SLC1A5 Antibody [NBP1-89327] - Staining of human placenta shows strong membranous positivity in trophoblastic cells.](http://images.novusbio.com/fullsize/SLC1A5-Antibody-Immunohistochemistry-Paraffin-NBP1-89327-img0007.jpg "Immunohistochemistry-Paraffin: SLC1A5 Antibody [NBP1-89327] - Staining of human placenta shows strong membranous positivity in trophoblastic cells.")
![Immunohistochemistry-Paraffin: SLC1A5 Antibody [NBP1-89327] - Staining of human prostate shows strong membranous positivity in glandular cells.](http://images.novusbio.com/fullsize/SLC1A5-Antibody-Immunohistochemistry-Paraffin-NBP1-89327-img0008.jpg "Immunohistochemistry-Paraffin: SLC1A5 Antibody [NBP1-89327] - Staining of human prostate shows strong membranous positivity in glandular cells.")
![Immunohistochemistry-Paraffin: SLC1A5 Antibody [NBP1-89327] - Staining of human rectum shows moderate to strong membranous positivity in glandular cells.](http://images.novusbio.com/fullsize/SLC1A5-Antibody-Immunohistochemistry-Paraffin-NBP1-89327-img0009.jpg "Immunohistochemistry-Paraffin: SLC1A5 Antibody [NBP1-89327] - Staining of human rectum shows moderate to strong membranous positivity in glandular cells.")
![Immunohistochemistry-Paraffin: SLC1A5 Antibody [NBP1-89327] - Staining of human skeletal muscle shows no positivity in striated muscle fibers as expected.](http://images.novusbio.com/fullsize/SLC1A5-Antibody-Immunohistochemistry-Paraffin-NBP1-89327-img0010.jpg "Immunohistochemistry-Paraffin: SLC1A5 Antibody [NBP1-89327] - Staining of human skeletal muscle shows no positivity in striated muscle fibers as expected.")
![SDS-PAGE EGF [Unconjugated]](https://images.novusbio.com/images2/EGF_236-EG_234.jpg)
![Bioactivity EGF [Unconjugated]](https://images.novusbio.com/images2/EGF_236EG_1570.jpg)
![Cell Culture EGF [Unconjugated]](https://images.novusbio.com/images/236-eg_recombinant-human-egf-protein-cf-bioactivity-25202394053.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")
