![Immunohistochemistry-Paraffin: SLC38A2 Antibody [NBP1-88872] - Staining of human endometrium shows moderate cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/SLC38A2-Antibody-Immunohistochemistry-Paraffin-NBP1-88872-img0009.jpg "Immunohistochemistry-Paraffin: SLC38A2 Antibody [NBP1-88872] - Staining of human endometrium shows moderate cytoplasmic positivity in glandular cells.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: MKKAEMGRFSISPDEDSSSYSSNSDFNYSYPTKQAALKSHYADVDPENQNFLLESNLGKKKYETEFHP |
| Predicted Species | Mouse (96%), Rat (93%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | SLC38A2 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Western Blot Serotonin N-acetyltransferase [p Thr29] Antibody - BSA Free](https://images.novusbio.com/images/Serotonin-N-acetyltransferase-[p-Thr29]-Antibody-Western-Blot-NB120-3439-img0003.jpg)
![Western Blot NTAL Antibody [Unconjugated]](https://images.novusbio.com/images2/NTAL_AF4066_Western_Blot_5396.jpg)
![Intracellular Staining by Flow Cytometry NTAL Antibody [Unconjugated]](https://images.novusbio.com/images2/NTAL_AF4066_Flow_Cytometry_8223.jpg)
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | SLC38A2 |
![Immunohistochemistry-Paraffin: SLC38A2 Antibody [NBP1-88872] - Staining of human kidney shows moderate cytoplasmic granular positivity in cells in tubules.](http://images.novusbio.com/fullsize/SLC38A2-Antibody-Immunohistochemistry-Paraffin-NBP1-88872-img0005.jpg "Immunohistochemistry-Paraffin: SLC38A2 Antibody [NBP1-88872] - Staining of human kidney shows moderate cytoplasmic granular positivity in cells in tubules.")
![Immunohistochemistry-Paraffin: SLC38A2 Antibody [NBP1-88872] - Staining of human placenta shows moderate cytoplasmic positivity in trophoblastic cells.](http://images.novusbio.com/fullsize/SLC38A2-Antibody-Immunohistochemistry-Paraffin-NBP1-88872-img0006.jpg "Immunohistochemistry-Paraffin: SLC38A2 Antibody [NBP1-88872] - Staining of human placenta shows moderate cytoplasmic positivity in trophoblastic cells.")
![Immunohistochemistry-Paraffin: SLC38A2 Antibody [NBP1-88872] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in neurons.](http://images.novusbio.com/fullsize/SLC38A2-Antibody-Immunohistochemistry-Paraffin-NBP1-88872-img0008.jpg "Immunohistochemistry-Paraffin: SLC38A2 Antibody [NBP1-88872] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in neurons.")
![Immunohistochemistry-Paraffin TOR/mTOR [p Ser2448] Antibody](https://images.novusbio.com/images/TOR-mTOR-[p-Ser2448]-Antibody-Immunohistochemistry-Paraffin-NB600-607-img0005.jpg)
![Western Blot TOR/mTOR [p Ser2448] Antibody](https://images.novusbio.com/images/TOR-mTOR-[p-Ser2448]-Antibody-Western-Blot-NB600-607-img0006.jpg)
![Data TOR/mTOR [p Ser2448] Antibody](https://images.novusbio.com/images/TOR-mTOR-[p-Ser2448]-Antibody-N-A-NB600-607-img0008.jpg)
![Immunocytochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/Insulin_MAB1417_Immunocytochemistry_9376.jpg)
![Immunohistochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/mab1417_human-bovine-mouse-insulin-mab-clone-182410-immunohistochemistry-308202115145.jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![SDS-PAGE IGF-II/IGF2 [Unconjugated]](https://images.novusbio.com/images2/IGF-II_292-G2_668.jpg)
![Bioactivity IGF-II/IGF2 [Unconjugated]](https://images.novusbio.com/images2/IGF-II_292-G2_669.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")