![Immunohistochemistry-Paraffin: SLC38A5 Antibody [NBP1-92402] - Analysis in human pancreas and skeletal muscle tissues using NBP1-92402 antibody. Corresponding SLC38A5 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/SLC38A5-Antibody-Immunohistochemistry-Paraffin-NBP1-92402-img0006.jpg "Immunohistochemistry-Paraffin: SLC38A5 Antibody [NBP1-92402] - Analysis in human pancreas and skeletal muscle tissues using NBP1-92402 antibody. Corresponding SLC38A5 RNA-seq data are presented for the same tissues.")
| Reactivity | HuSpecies Glossary |
| Applications | ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: MELQDPKMNGALPSDAVGYRQEREGFLPSRGPAPGSKPVQFMDFE |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | SLC38A5 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Western Blot Serotonin N-acetyltransferase [p Thr29] Antibody - BSA Free](https://images.novusbio.com/images/Serotonin-N-acetyltransferase-[p-Thr29]-Antibody-Western-Blot-NB120-3439-img0003.jpg)
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | SLC38A5 |
![Immunocytochemistry/Immunofluorescence: SLC38A5 Antibody [NBP1-92402] - Immunofluorescent staining of human cell line HeLa shows localization to plasma membrane, cytosol & vesicles. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/SLC38A5-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-92402-img0004.jpg "Immunocytochemistry/Immunofluorescence: SLC38A5 Antibody [NBP1-92402] - Immunofluorescent staining of human cell line HeLa shows localization to plasma membrane, cytosol & vesicles. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: SLC38A5 Antibody [NBP1-92402] - Staining of human skeletal muscle shows no positivity in myoctes as expected.](http://images.novusbio.com/fullsize/SLC38A5-Antibody-Immunohistochemistry-Paraffin-NBP1-92402-img0010.jpg "Immunohistochemistry-Paraffin: SLC38A5 Antibody [NBP1-92402] - Staining of human skeletal muscle shows no positivity in myoctes as expected.")
![Immunohistochemistry-Paraffin: SLC38A5 Antibody [NBP1-92402] - Staining of human pancreas shows moderate membranous positivity in exocrine glandular cells.](http://images.novusbio.com/fullsize/SLC38A5-Antibody-Immunohistochemistry-Paraffin-NBP1-92402-img0007.jpg "Immunohistochemistry-Paraffin: SLC38A5 Antibody [NBP1-92402] - Staining of human pancreas shows moderate membranous positivity in exocrine glandular cells.")
![Immunohistochemistry-Paraffin: SLC38A5 Antibody [NBP1-92402] - Staining of human stomach shows moderate membranous positivity in glandular cells.](http://images.novusbio.com/fullsize/SLC38A5-Antibody-Immunohistochemistry-Paraffin-NBP1-92402-img0008.jpg "Immunohistochemistry-Paraffin: SLC38A5 Antibody [NBP1-92402] - Staining of human stomach shows moderate membranous positivity in glandular cells.")
![Immunohistochemistry-Paraffin: SLC38A5 Antibody [NBP1-92402] - Staining of human liver shows no positivity in hepatocytes as expected.](http://images.novusbio.com/fullsize/SLC38A5-Antibody-Immunohistochemistry-Paraffin-NBP1-92402-img0009.jpg "Immunohistochemistry-Paraffin: SLC38A5 Antibody [NBP1-92402] - Staining of human liver shows no positivity in hepatocytes as expected.")
![Immunocytochemistry Integrin alpha 2/CD49b Antibody (HAS3) [Unconjugated]](https://images.novusbio.com/images2/Integrin_alpha_2_MAB1233_Immunocytochemistry__Immunofluorescence_19196.jpg)
![Flow Cytometry Integrin alpha 2/CD49b Antibody (HAS3) [Unconjugated]](https://images.novusbio.com/images2/Integrin_alpha_2_MAB1233_Flow_Cytometry_19476.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")