I have a customer who is interested this RAC3 antibody (Cat#H00005881-D01P) for Western blotting. They were asking how specific this antibody is for RAC3 (versus other RAC proteins - with which RAC3 shares a high level of sequence similarity)? Does this antibody cross-react with RAC 1 and 2? Are there any western blot images of non-transfected, whole cell lysates? (the example image on website has transfected cell line expression on Western blot).

Name: RAC3 Antibody
Brand: Novus Biologicals
SKU: H00005881-D01P
Price: 549 USD

Question

Accepted Answer

This antibody is produced by a Taiwanese company called Abnova and we distribute for them. We do no in-house testing or development on their products. The only images available are the ones that Abnova has generated. This is a polyclonal antibody and the immunogen is full-length RAC3. RAC3 shares 94% and 89% similarity with RAC1 and RAC2, respectively. Chances of cross-reactivity with other RAC proteins is quite high. This is true for probably any polyclonal antibody commercially produced against RAC3. A monoclonal is probably the best bet for this target.

At	=	A. thaliana	SyHa	=	Golden Syrian Hamster
All	=	All Species	Ha	=	Hamster
An	=	Animal	Hu	=	Human
ArHa	=	Armenian Hamster	I	=	Insect
Av	=	Avian	Ll	=	Llama
Bb	=	Baboon	Ma	=	Mammal
Ba	=	Bacteria	Mk	=	Monkey
Bv	=	Bovine	Mu	=	Mouse
Ca	=	Canine	Multi	=	Multi-species
Ce	=	C. Elegans	NA	=	Non-species specific
Ch	=	Chicken	Or	=	Orangutan
ChHa	=	Chinese Hamster	Pl	=	Plant
Cm	=	Cynomolgus Monkey	Pm	=	Primate
Do	=	Donkey	Po	=	Porcine
Dr	=	Drosophilia	Rb	=	Rabbit
Ec	=	E. Coli	Rt	=	Rat
Eq	=	Equine	RM	=	Rhesus Macaque
Fe	=	Feline	Sh	=	Sheep
Ft	=	Ferret	Vb	=	Vertebrate
Fi	=	Fish	Vi	=	Virus
Fu	=	Fungi	Xp	=	Xenopus
Ge	=	Gerbil	Ye	=	Yeast
GP	=	Guinea Pig	Ze	=	Zebrafish
Gt	=	Goat

Reactivity	HuSpecies Glossary
Applications	WB
Clonality	Polyclonal
Host	Rabbit
Conjugate	Unconjugated

Description	Quality control test: Antibody reactive against mammalian transfected lysate.
Immunogen	RAC3 (NP_005043.1, 1 a.a. - 192 a.a.) full-length human protein. MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPHTPILLVGTKLDLRDDKDTIERLRDKKLAPITYPQGLAMAREIGSVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKKPGKKCTVF
Specificity	Reacts with ras-related C3 botulinum toxin substrate 3 (rho family, small GTP binding protein Rac3).
Isotype	IgG
Clonality	Polyclonal
Host	Rabbit
Gene	RAC3
Purity	Protein A purified
Innovator's Reward	Test in a species/application not listed above to receive a full credit towards a future purchase. Learn about the Innovator's Reward

Dilutions	Western Blot
Application Notes	This antibody is reactive against transfected lysate in WB and as a detection antibody in ELISA.

Storage	Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer	PBS (pH 7.4)
Preservative	No Preservative
Purity	Protein A purified

RAC3 Antibody

Species Glossary

Images

Product Details

Order Details

RAC3 Antibody Summary

Applications/Dilutions

Packaging, Storage & Formulations

Notes

Alternate Names for RAC3 Antibody

Background

Limitations

Customers Who Viewed This Item Also Viewed...

Publications for RAC3 Antibody (H00005881-D01P) (0)

Reviews for RAC3 Antibody (H00005881-D01P) (0)

Product General Protocols

Video Protocols

FAQs for RAC3 Antibody (H00005881-D01P). (Showing 1 - 1 of 1 FAQ).

Secondary Antibodies

Isotype Controls

Additional RAC3 Products

Research Areas for RAC3 Antibody (H00005881-D01P)

Blogs on RAC3

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Review this Product

Bioinformatics

Gene Symbol	RAC3
Entrez	5881(Human)
Uniprot	NP_005043.1(Human)