![Immunohistochemistry-Paraffin: RAB23 Antibody [NBP1-86366] - Staining in human smooth muscle and skeletal muscle tissues using anti-RAB23 antibody. Corresponding RAB23 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/RAB23-Antibody-Immunohistochemistry-Paraffin-NBP1-86366-img0009.jpg "Immunohistochemistry-Paraffin: RAB23 Antibody [NBP1-86366] - Staining in human smooth muscle and skeletal muscle tissues using anti-RAB23 antibody. Corresponding RAB23 RNA-seq data are presented for the same tissues.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: EDLNVNEVFKYLAEKYLQKLKQQIAEDPELTHSSSNKIGVFNTSGGSHSGQNSGTLNGGDVINLRPNKQRTKK |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | RAB23 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for RAB23 Antibody (NBP1-86366)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | RAB23 |
![Western Blot: RAB23 Antibody [NBP1-86366] - Analysis in control (vector only transfected HEK293T lysate) and RAB23 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).](http://images.novusbio.com/fullsize/RAB23-Antibody-Western-Blot-NBP1-86366-img0011.jpg "Western Blot: RAB23 Antibody [NBP1-86366] - Analysis in control (vector only transfected HEK293T lysate) and RAB23 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).")
![Immunocytochemistry/Immunofluorescence: RAB23 Antibody [NBP1-86366] - Staining of human cell line U-2 OS shows localization to plasma membrane, cytosol and centrosome.](http://images.novusbio.com/fullsize/RAB23-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-86366-img0010.jpg "Immunocytochemistry/Immunofluorescence: RAB23 Antibody [NBP1-86366] - Staining of human cell line U-2 OS shows localization to plasma membrane, cytosol and centrosome.")
![Immunohistochemistry-Paraffin: RAB23 Antibody [NBP1-86366] - Staining of human skeletal muscle shows low expression as expected.](http://images.novusbio.com/fullsize/RAB23-Antibody-Immunohistochemistry-Paraffin-NBP1-86366-img0007.jpg "Immunohistochemistry-Paraffin: RAB23 Antibody [NBP1-86366] - Staining of human skeletal muscle shows low expression as expected.")
![Immunohistochemistry-Paraffin: RAB23 Antibody [NBP1-86366] - Staining of human smooth muscle shows high expression.](http://images.novusbio.com/fullsize/RAB23-Antibody-Immunohistochemistry-Paraffin-NBP1-86366-img0008.jpg "Immunohistochemistry-Paraffin: RAB23 Antibody [NBP1-86366] - Staining of human smooth muscle shows high expression.")
![Bioactivity Sonic Hedgehog/Shh [Unconjugated]](https://images.novusbio.com/images2/Sonic_Hedgehog_464SH_2840.jpg)
![SDS-PAGE Sonic Hedgehog/Shh [Unconjugated]](https://images.novusbio.com/images2/Sonic_Hedgehog_464-SH_341.jpg)
![SEC-MALS Sonic Hedgehog/Shh [Unconjugated]](https://images.novusbio.com/images/464-sh_recombinant-mouse-sonic-hedgehog-shh-c25ii-n-terminus-sec-mals-642023224324.jpg)
![Immunohistochemistry Patched 1/PTCH Antibody (413220) [Unconjugated] - (First Extracellular Loop)](https://images.novusbio.com/images2/Patched_1_MAB41051_Immunohistochemistry_15456.jpg)
![Western Blot Patched 1/PTCH Antibody (413220) [Unconjugated] - (First Extracellular Loop)](https://images.novusbio.com/images2/Patched_1_MAB41051_Western_Blot_10905.jpg)
![Immunohistochemistry Patched 1/PTCH Antibody (413220) [Unconjugated] - (First Extracellular Loop)](https://images.novusbio.com/images2/Patched_1_MAB41051_Immunohistochemistry_7016.jpg)
![Western Blot Gas1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Gas1_AF2644_Western_Blot_18066.jpg)
![Immunocytochemistry/ Immunofluorescence Gas1 Antibody [Unconjugated]](https://images.novusbio.com/images/af2644_mouse-gas1-affinity-purified-polyclonal-ab-412024124024.jpg)
![Immunocytochemistry/ Immunofluorescence Gas1 Antibody [Unconjugated]](https://images.novusbio.com/images/af2644_mouse-gas1-affinity-purified-polyclonal-ab-41202412394983.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")