![Immunohistochemistry-Paraffin: Purine Nucleoside Phosphorylase/PNP Antibody [NBP1-82541] - Staining in human epididymis and testis tissues using anti-PNP antibody. Corresponding PNP RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/Purine-Nucleoside-Phosphorylase-PNP-Antibody-Immunohistochemistry-Paraffin-NBP1-82541-img0020.jpg "Immunohistochemistry-Paraffin: Purine Nucleoside Phosphorylase/PNP Antibody [NBP1-82541] - Staining in human epididymis and testis tissues using anti-PNP antibody. Corresponding PNP RNA-seq data are presented for the same tissues.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: YTYEDYKNTAEWLLSHTKHRPQVAIICGSGLGGLTDKLTQAQIFDYGEIPNFPRSTVPGHAGRLVFGFLNGRACVMMQGRFHMYEGYPLWKVTFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSGQNPLRGPNDERGAPHR |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | PNP |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for Purine Nucleoside Phosphorylase/PNP Antibody (NBP1-82541)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | PNP |
![Western Blot: Purine Nucleoside Phosphorylase/PNP Antibody [NBP1-82541] - Analysis in human cell lines HEK293 and SK-MEL-30 using Anti-PNP antibody. Corresponding PNP RNA-seq data are presented for the same cell lines. Loading control: Anti-PFN1.](http://images.novusbio.com/fullsize/Purine-Nucleoside-Phosphorylase-PNP-Antibody-Western-Blot-NBP1-82541-img0015.jpg "Western Blot: Purine Nucleoside Phosphorylase/PNP Antibody [NBP1-82541] - Analysis in human cell lines HEK293 and SK-MEL-30 using Anti-PNP antibody. Corresponding PNP RNA-seq data are presented for the same cell lines. Loading control: Anti-PFN1.")
![Immunocytochemistry/Immunofluorescence: Purine Nucleoside Phosphorylase/PNP Antibody [NBP1-82541] - Staining of human cell line RPTEC TERT1 shows localization to cytosol. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/Purine-Nucleoside-Phosphorylase-PNP-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-82541-img0022.jpg "Immunocytochemistry/Immunofluorescence: Purine Nucleoside Phosphorylase/PNP Antibody [NBP1-82541] - Staining of human cell line RPTEC TERT1 shows localization to cytosol. Antibody staining is shown in green.")
![Western Blot: Purine Nucleoside Phosphorylase/PNP Antibody [NBP1-82541] - Western blot analysis in mouse cell line NIH-3T3, rat cell line NBT-II and rat cell line pC12.](http://images.novusbio.com/fullsize/Purine-Nucleoside-Phosphorylase-PNP-Antibody-Western-Blot-NBP1-82541-img0012.jpg "Western Blot: Purine Nucleoside Phosphorylase/PNP Antibody [NBP1-82541] - Western blot analysis in mouse cell line NIH-3T3, rat cell line NBT-II and rat cell line pC12.")
![Immunohistochemistry-Paraffin: Purine Nucleoside Phosphorylase/PNP Antibody [NBP1-82541] - Staining of human epididymis shows high expression.](http://images.novusbio.com/fullsize/Purine-Nucleoside-Phosphorylase-PNP-Antibody-Immunohistochemistry-Paraffin-NBP1-82541-img0018.jpg "Immunohistochemistry-Paraffin: Purine Nucleoside Phosphorylase/PNP Antibody [NBP1-82541] - Staining of human epididymis shows high expression.")
![Immunohistochemistry-Paraffin: Purine Nucleoside Phosphorylase/PNP Antibody [NBP1-82541] - Staining of human testis shows low expression as expected.](http://images.novusbio.com/fullsize/Purine-Nucleoside-Phosphorylase-PNP-Antibody-Immunohistochemistry-Paraffin-NBP1-82541-img0019.jpg "Immunohistochemistry-Paraffin: Purine Nucleoside Phosphorylase/PNP Antibody [NBP1-82541] - Staining of human testis shows low expression as expected.")
![Western Blot Prostatic Acid Phosphatase/ACPP Antibody [Unconjugated]](https://images.novusbio.com/images2/Prostatic_Acid_Phosphatase_AF6240_Western_Blot_10680.jpg)
![Immunohistochemistry Prostatic Acid Phosphatase/ACPP Antibody [Unconjugated]](https://images.novusbio.com/images2/Prostatic_Acid_Phosphatase_AF6240_Immunohistochemistry_10732.jpg)
![ELISA Prostatic Acid Phosphatase/ACPP Antibody [Unconjugated]](https://images.novusbio.com/images2/Prostatic_Acid_Phosphatase_AF6240_ELISA_22233.jpg)
![Bioactivity IL-2 [Unconjugated]](https://images.novusbio.com/images/202-il_recombinant-human-il-2-protein-bioactivity-174202314946.jpg)
![Western Blot Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Western_Blot_5287.jpg)
![Simple Western Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Simple_Western_16990.jpg)
![Knockout Validated Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Knockout_Validated_24032.jpg)
![Western Blot Serpin A1/alpha 1-Antitrypsin Antibody (202808) [Unconjugated]](https://images.novusbio.com/images2/Serpin_A1_MAB1268_Western_Blot_17309.jpg)
![Simple Western Serpin A1/alpha 1-Antitrypsin Antibody (202808) [Unconjugated]](https://images.novusbio.com/images2/Serpin_A1_MAB1268_Immunocytochemistry__Immunofluorescence_17494.jpg)
![Immunocytochemistry Serpin A1/alpha 1-Antitrypsin Antibody (202808) [Unconjugated]](https://images.novusbio.com/images2/Serpin_A1_MAB1268_Immunocytochemistry_11973.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")