![Immunocytochemistry/Immunofluorescence: Guanine deaminase Antibody [NBP1-87454] - Immunofluorescent staining of human cell line A-431 shows localization to nucleus.](http://images.novusbio.com/fullsize/Guanine-deaminase-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-87454-img0007.jpg "Immunocytochemistry/Immunofluorescence: Guanine deaminase Antibody [NBP1-87454] - Immunofluorescent staining of human cell line A-431 shows localization to nucleus.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: NKVNEKSLTLKEVFRLATLGGSQALGLDGEIGNFEVGKEFDAILINPKASDSPIDLFYGDFFGDISEAVIQKFLYLGDDRNIEEVYVGGKQVVPF |
| Predicted Species | Mouse (95%), Rat (94%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | GDA |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for Guanine deaminase Antibody (NBP1-87454)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | GDA |
![Immunohistochemistry-Paraffin: Guanine deaminase Antibody [NBP1-87454] - Staining of human lymph node using Anti-GDA antibody NBP1-87454.](http://images.novusbio.com/fullsize/Guanine-deaminase-Antibody-Immunohistochemistry-Paraffin-NBP1-87454-img0015.jpg "Immunohistochemistry-Paraffin: Guanine deaminase Antibody [NBP1-87454] - Staining of human lymph node using Anti-GDA antibody NBP1-87454.")
![Immunohistochemistry-Paraffin: Guanine deaminase Antibody [NBP1-87454] - Staining of human kidney shows high expression.](http://images.novusbio.com/fullsize/Guanine-deaminase-Antibody-Immunohistochemistry-Paraffin-NBP1-87454-img0008.jpg "Immunohistochemistry-Paraffin: Guanine deaminase Antibody [NBP1-87454] - Staining of human kidney shows high expression.")
![Immunohistochemistry-Paraffin: Guanine deaminase Antibody [NBP1-87454] - Staining of human lymph node shows low expression as expected.](http://images.novusbio.com/fullsize/Guanine-deaminase-Antibody-Immunohistochemistry-Paraffin-NBP1-87454-img0009.jpg "Immunohistochemistry-Paraffin: Guanine deaminase Antibody [NBP1-87454] - Staining of human lymph node shows low expression as expected.")
![Immunohistochemistry-Paraffin: Guanine deaminase Antibody [NBP1-87454] - Staining in human kidney and lymph node tissues using anti-GDA antibody. Corresponding GDA RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/Guanine-deaminase-Antibody-Immunohistochemistry-Paraffin-NBP1-87454-img0010.jpg "Immunohistochemistry-Paraffin: Guanine deaminase Antibody [NBP1-87454] - Staining in human kidney and lymph node tissues using anti-GDA antibody. Corresponding GDA RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: Guanine deaminase Antibody [NBP1-87454] - Staining of human cerebral cortex, duodenum, kidney and lymph node using Anti-GDA antibody NBP1-87454 (A) shows similar protein distribution across tissues to independent antibody NBP1-87562 (B).](http://images.novusbio.com/fullsize/Guanine-deaminase-Antibody-Immunohistochemistry-Paraffin-NBP1-87454-img0011.jpg "Immunohistochemistry-Paraffin: Guanine deaminase Antibody [NBP1-87454] - Staining of human cerebral cortex, duodenum, kidney and lymph node using Anti-GDA antibody NBP1-87454 (A) shows similar protein distribution across tissues to independent antibody NBP1-87562 (B).")
![Immunohistochemistry-Paraffin: Guanine deaminase Antibody [NBP1-87454] - Staining of human cerebral cortex.](http://images.novusbio.com/fullsize/Guanine-deaminase-Antibody-Immunohistochemistry-Paraffin-NBP1-87454-img0012.jpg "Immunohistochemistry-Paraffin: Guanine deaminase Antibody [NBP1-87454] - Staining of human cerebral cortex.")
![Immunohistochemistry-Paraffin: Guanine deaminase Antibody [NBP1-87454] - Staining of human duodenum.](http://images.novusbio.com/fullsize/Guanine-deaminase-Antibody-Immunohistochemistry-Paraffin-NBP1-87454-img0013.jpg "Immunohistochemistry-Paraffin: Guanine deaminase Antibody [NBP1-87454] - Staining of human duodenum.")
![Immunohistochemistry-Paraffin: Guanine deaminase Antibody [NBP1-87454] - Staining of human kidney using Anti-GDA antibody NBP1-87454.](http://images.novusbio.com/fullsize/Guanine-deaminase-Antibody-Immunohistochemistry-Paraffin-NBP1-87454-img0014.jpg "Immunohistochemistry-Paraffin: Guanine deaminase Antibody [NBP1-87454] - Staining of human kidney using Anti-GDA antibody NBP1-87454.")
![Western Blot Prostatic Acid Phosphatase/ACPP Antibody [Unconjugated]](https://images.novusbio.com/images2/Prostatic_Acid_Phosphatase_AF6240_Western_Blot_10680.jpg)
![Immunohistochemistry Prostatic Acid Phosphatase/ACPP Antibody [Unconjugated]](https://images.novusbio.com/images2/Prostatic_Acid_Phosphatase_AF6240_Immunohistochemistry_10732.jpg)
![ELISA Prostatic Acid Phosphatase/ACPP Antibody [Unconjugated]](https://images.novusbio.com/images2/Prostatic_Acid_Phosphatase_AF6240_ELISA_22233.jpg)
![Western Blot Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Western_Blot_5287.jpg)
![Simple Western Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Simple_Western_16990.jpg)
![Knockout Validated Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Knockout_Validated_24032.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")