PP14/Glycodelin Antibody Summary
Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: QDLELPKLAGTWHSMAMATNNISLMATLKAPLRVHITSLLPTPEDNLEIVLHRWENNSCVEKKVLGEKTENPKKFKI |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
PAEP |
Purity |
Immunogen affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunohistochemistry 1:1000 - 1:2500
- Immunohistochemistry-Paraffin 1:1000 - 1:2500
- Western Blot 0.04-0.4 ug/ml
|
Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
Control Peptide |
|
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.2) and 40% Glycerol |
Preservative |
0.02% Sodium Azide |
Purity |
Immunogen affinity purified |
Alternate Names for PP14/Glycodelin Antibody
Background
PAEP (Progesterone-associated endometrial protein, glycodelin, PEG, PP14) is a glycoprotein belonging to lipocalin structural superfamily. It shares a sequence homology to beta-lactoglobulins containing a retinol-binding motif and it is mainly produced by secretory and decidualized endometrium in women and by seminal vesicle epithelium in men (1). PAEP function is not clearly understood. However, glycosylated version of PAEP (GdA) has been associated to contraceptive and immunosuppressive activities during reproduction. PAEP is the main protein produced by secretory endometrium during mid-luteal phase of the menstrual cycle and during the first semester of pregnancy. Therefore, PAEP has been linked as an ideal biomarker of endometrial activity and function for in vitro fertilization treated women (2).
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ELISA
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC, IHC, Simple Western, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu
Applications: WB
Species: Hu, Mu
Applications: ELISA, ICC/IF, IP, WB
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
Species: Hu, Mu
Applications: IHC-P, WB
Species: Hu
Applications: BA
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
Species: Hu
Applications: BA
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu
Applications: WB, IHC
Publications for PP14/Glycodelin Antibody (NBP1-89781) (0)
There are no publications for PP14/Glycodelin Antibody (NBP1-89781).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for PP14/Glycodelin Antibody (NBP1-89781) (0)
There are no reviews for PP14/Glycodelin Antibody (NBP1-89781).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for PP14/Glycodelin Antibody (NBP1-89781) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional PP14/Glycodelin Products
Blogs on PP14/Glycodelin