![Western Blot: Xanthine Oxidase Antibody (0M8E7) [NBP3-16735] - Western blot analysis of extracts of various cell lines, using Xanthine Oxidase (XDH) Rabbit mAb (NBP3-16735) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 60s.](http://images.novusbio.com/fullsize/Xanthine-Oxidase-Antibody-0M8E7-Western-Blot-NBP3-16735-img0005.jpg "Western Blot: Xanthine Oxidase Antibody (0M8E7) [NBP3-16735] - Western blot analysis of extracts of various cell lines, using Xanthine Oxidase (XDH) Rabbit mAb (NBP3-16735) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 60s.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ELISA, ICC/IF, IHC |
| Clone | 0M8E7 |
| Clonality | Monoclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Additional Information | Recombinant Monoclonal Antibody |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 202-293 of human Xanthine Oxidase (XDH) (P47989). TPLDPTQEPIFPPELLRLKDTPRKQLRFEGERVTWIQASTLKELLDLKAQHPDAKLVVGNTEIGIEMKFKNMLFPMIVCPAWIPELNSVEHG |
| Isotype | IgG |
| Clonality | Monoclonal |
| Host | Rabbit |
| Gene | XDH |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Theoretical MW | 146 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.3), 50% glycerol, 0.05% BSA |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
![Western Blot Aldehyde Oxidase 1/AOX1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Aldehyde_Oxidase_1_AF5928_Western_Blot_5882.jpg)
![Immunohistochemistry Aldehyde Oxidase 1/AOX1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Aldehyde_Oxidase_1_AF5928_Immunohistochemistry_19616.jpg)
![Immunocytochemistry Aldehyde Oxidase 1/AOX1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Aldehyde_Oxidase_1_AF5928_Immunocytochemistry__Immunofluorescence_19724.jpg)
![Western Blot Myeloperoxidase/MPO Antibody [Unconjugated]](https://images.novusbio.com/images2/Myeloperoxidase_AF3667_Western_Blot_5321.jpg)
![Simple Western Myeloperoxidase/MPO Antibody [Unconjugated]](https://images.novusbio.com/images2/Myeloperoxidase_AF3667_Simple_Western_16637.jpg)
![Immunocytochemistry Myeloperoxidase/MPO Antibody [Unconjugated]](https://images.novusbio.com/images2/Myeloperoxidase_AF3667_Immunocytochemistry__Immunofluorescence_17390.jpg)
![Simple Western Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Simple_Western_21888.jpg)
![Immunocytochemistry Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Immunocytochemistry__Immunofluorescence_17777.jpg)
![Immunohistochemistry Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Immunohistochemistry_23317.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for Xanthine Oxidase Antibody (NBP3-16735)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | XDH |
![Immunocytochemistry/Immunofluorescence: Xanthine Oxidase Antibody (0M8E7) [NBP3-16735] - Immunofluorescence analysis of NIH-3T3 cells using Xanthine Oxidase (XDH) Rabbit mAb (NBP3-16735) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/Xanthine-Oxidase-Antibody-0M8E7-Immunocytochemistry-Immunofluorescence-NBP3-16735-img0004.jpg "Immunocytochemistry/Immunofluorescence: Xanthine Oxidase Antibody (0M8E7) [NBP3-16735] - Immunofluorescence analysis of NIH-3T3 cells using Xanthine Oxidase (XDH) Rabbit mAb (NBP3-16735) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.")
![Immunohistochemistry-Paraffin: Xanthine Oxidase Antibody (0M8E7) [NBP3-16735] - Mouse brain using Xanthine Oxidase (XDH) Rabbit mAb (NBP3-16735) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.](http://images.novusbio.com/fullsize/Xanthine-Oxidase-Antibody-0M8E7-Immunohistochemistry-Paraffin-NBP3-16735-img0003.jpg "Immunohistochemistry-Paraffin: Xanthine Oxidase Antibody (0M8E7) [NBP3-16735] - Mouse brain using Xanthine Oxidase (XDH) Rabbit mAb (NBP3-16735) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.")
![Immunohistochemistry-Paraffin: Xanthine Oxidase Antibody (0M8E7) [NBP3-16735] - Rat kidney using Xanthine Oxidase (XDH) Rabbit mAb (NBP3-16735) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.](http://images.novusbio.com/fullsize/Xanthine-Oxidase-Antibody-0M8E7-Immunohistochemistry-Paraffin-NBP3-16735-img0001.jpg "Immunohistochemistry-Paraffin: Xanthine Oxidase Antibody (0M8E7) [NBP3-16735] - Rat kidney using Xanthine Oxidase (XDH) Rabbit mAb (NBP3-16735) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.")
![Immunohistochemistry-Paraffin: Xanthine Oxidase Antibody (0M8E7) [NBP3-16735] - Human oophoroma using Xanthine Oxidase (XDH) Rabbit mAb (NBP3-16735) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.](http://images.novusbio.com/fullsize/Xanthine-Oxidase-Antibody-0M8E7-Immunohistochemistry-Paraffin-NBP3-16735-img0002.jpg "Immunohistochemistry-Paraffin: Xanthine Oxidase Antibody (0M8E7) [NBP3-16735] - Human oophoroma using Xanthine Oxidase (XDH) Rabbit mAb (NBP3-16735) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.")
![Western Blot Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Western_Blot_5287.jpg)
![Simple Western Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Simple_Western_16990.jpg)
![Knockout Validated Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Knockout_Validated_24032.jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![Western Blot BRCA2 Antibody (234403) [Unconjugated]](https://images.novusbio.com/images2/BRCA2_MAB2476_Western_Blot_6033.jpg)
![Immunohistochemistry BRCA2 Antibody (234403) [Unconjugated]](https://images.novusbio.com/images2/mab2476_human-brca2-mab-clone-234403-immunohistochemistry-10520211657.jpg)
![Western Blot BRCA2 Antibody (234403) [Unconjugated]](https://images.novusbio.com/images/mab2476_human-brca2-mab-clone-234403-2282024172111.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")