Home » PTEN » PTEN Proteins » PTEN Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

PTEN Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for PTEN Recombinant Protein Antigen (NBP3-21254PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

PTEN Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PTEN

Source: E.coli

Amino Acid Sequence: VAQYPFEDHNPPQLELIKPFCEDLDQWLSEDDNHVAAIHCKAGKGRTGVMICAYLLHRGKFLKAQEALDFYGEVRT

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PTEN
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-21254. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com For further blocking peptide related information and a protocol, click here.
Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for PTEN Recombinant Protein Antigen

  • BZS
  • EC 3.1.3.16,10q23del
  • EC 3.1.3.48
  • EC 3.1.3.67
  • GLM2
  • MMAC1 phosphatase and tensin homolog deleted on chromosome 10
  • MMAC1
  • MMAC1MGC11227
  • Mutated in multiple advanced cancers 1
  • phosphatase and tensin homologDEC
  • phosphatidylinositol-34,5-trisphosphate 3-phosphatase and dual-specificityprotein phosphatase PTEN
  • PTEN
  • PTEN1
  • TEP1MHAM

Background

PTEN is a protein tyrosine phosphatase that acts as a tumor suppressor, as a lipid phosphatase that dephosphorylates the D3 position of phosphatidylinositol 3,4,5-trisphosphate and as an antagonist of the PI3k/AKT signaling pathway (1-3). PTEN structural domains includes an N-terminal phosphatase domain, a lipid binding C2 domain and a 50-amino acid C-terminal tail that contains a PD biding sequence (5). Phosporylation of the tail of the protein will suppress its activity and modify its conformation to a

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AKT [p Ser473]
Antibody [Unconjugate ...
AF887
Western Blot AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
Simple Western AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
Intracellular Staining by Flow Cytometry AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
(49 Publications)
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
PIK3CA Antibody
NBP2-19804
Western Blot PIK3CA Antibody
Immunohistochemistry-Paraffin PIK3CA Antibody
Western Blot PIK3CA Antibody
(4 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
PI 3-Kinase p110
gamma Antibody
NBP2-15071
Western Blot PI 3-Kinase p110 gamma Antibody
Immunohistochemistry-Paraffin PI 3-Kinase p110 gamma Antibody
Western Blot PI 3-Kinase p110 gamma Antibody
(3 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
PI 3-Kinase p110
beta/PIK3CB Antibody ...
MAB2686
Western Blot PI 3-Kinase p110 beta/PIK3CB Antibody (269020)
(5 Publications)
Species: Hu
Applications: WB
PI 3-Kinase p110
delta Antibody (OTI1D ...
NBP2-46404
Immunohistochemistry PI 3-Kinase p110 delta Antibody (OTI1D11)
Immunohistochemistry PI 3-Kinase p110 delta Antibody (OTI1D11)
Immunohistochemistry PI 3-Kinase p110 delta Antibody (OTI1D11)
(1 Review)
Species: Hu, Mu, Rt
Applications: IHC, IHC-P
EGFR Antibody
[Unconjugated]
AF231
Immunohistochemistry EGFR Antibody [Unconjugated]
Immunocytochemistry EGFR Antibody [Unconjugated]
Western Blot EGFR Antibody [Unconjugated]
(30 Publications)
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
TOR/mTOR [p
Ser2448] Antibody
NB600-607
Immunohistochemistry-Paraffin TOR/mTOR [p Ser2448] Antibody
Western Blot TOR/mTOR [p Ser2448] Antibody
Data TOR/mTOR [p Ser2448] Antibody
(2 Reviews)
(9 Publications)
Species: Hu, Rt
Applications: ELISA, IHC, IHC-P, WB
p53 Antibody (PAb
240) - BSA Free
NB200-103
Flow Cytometry p53 Antibody (PAb 240) - BSA Free
Flow Cytometry p53 Antibody (PAb 240) - BSA Free
Flow (Intracellular) p53 Antibody (PAb 240) - BSA Free
(3 Reviews)
(42 Publications)
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
p19ARF/CDKN2A
Antibody - BSA Free
NB200-106
Immunohistochemistry p19ARF/CDKN2A Antibody - BSA Free
Western Blot p19ARF/CDKN2A Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence p19ARF/CDKN2A Antibody - BSA Free
(1 Review)
(48 Publications)
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
PYK2/FAK2 [p
Tyr402] Antibody (592 ...
MAB6210
Simple Western PYK2/FAK2 [p Tyr402] Antibody (592918) [Unconjugated]
Western Blot PYK2/FAK2 [p Tyr402] Antibody (592918) [Unconjugated]
(1 Review)
(1 Publication)
Species: Hu
Applications: Simple Western, WB
ErbB2/Her2
[Unconjugated]
1129-ER
SDS-PAGE ErbB2/Her2 [Unconjugated]
Bioactivity ErbB2/Her2 [Unconjugated]
(58 Publications)
Species: Hu
Applications: BA
ERK2 Antibody
[Unconjugated]
AF1230
Western Blot ERK2 Antibody [Unconjugated]
Immunohistochemistry ERK2 Antibody [Unconjugated]
Knockout Validated ERK2 Antibody [Unconjugated]
(3 Publications)
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
p21/CIP1/CDKN1A
Antibody (WA-1)
NBP2-29463
Immunohistochemistry-Paraffin p21/CIP1/CDKN1A Antibody (WA-1)
(24 Publications)
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
VEGF [HRP]
DVE00
N/A VEGF [HRP]
N/A VEGF [HRP]
N/A VEGF [HRP]
(674 Publications)
Species: Hu
Applications: ELISA
Insulin Antibody
(182410) [Unconjugate ...
MAB1417
Immunocytochemistry Insulin Antibody (182410) [Unconjugated]
Immunohistochemistry Insulin Antibody (182410) [Unconjugated]
(24 Publications)
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
KRAS Antibody
(3B10-2F2)
H00003845-M01
Western Blot KRAS Antibody (3B10-2F2)
Western Blot KRAS Antibody (3B10-2F2)
Western Blot KRAS Antibody (3B10-2F2)
(1 Review)
(17 Publications)
Species: Hu, Mu
Applications: ELISA, ICC/IF, IP, WB
Cyclin D1 Antibody
(SPM587)
NBP2-32840
Western Blot Cyclin D1 Antibody (SPM587)
Flow Cytometry Cyclin D1 Antibody (SPM587)
Flow Cytometry Cyclin D1 Antibody (SPM587)
(1 Review)
(9 Publications)
Species: Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
B-Raf Antibody
(OTI5A9)
NBP1-47668
Immunohistochemistry B-Raf Antibody (OTI5A9)
Western Blot B-Raf Antibody (OTI5A9)
Flow Cytometry B-Raf Antibody (OTI5A9)
(1 Publication)
Species: Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
TMED7 Antibody
NBP1-90949
Immunohistochemistry TMED7 Antibody
Immunohistochemistry TMED7 Antibody
Immunohistochemistry TMED7 Antibody
(1 Publication)
Species: Hu
Applications: IHC, IHC-P, WB
PTEN Recombinant
Protein Antigen
NBP3-21254PEP
PTEN Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for PTEN Recombinant Protein Antigen (NBP3-21254PEP) (0)

There are no publications for PTEN Recombinant Protein Antigen (NBP3-21254PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PTEN Recombinant Protein Antigen (NBP3-21254PEP) (0)

There are no reviews for PTEN Recombinant Protein Antigen (NBP3-21254PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for PTEN Recombinant Protein Antigen (NBP3-21254PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PTEN Products

Research Areas for PTEN Recombinant Protein Antigen (NBP3-21254PEP)

Find related products by research area.

Blogs on PTEN.

Check out the latest blog posts on PTEN.
Autophagy Research Update: What a difference a year makes!
By Christina Towers, PhD Over the last two decades the field of autophagy has exploded! Innovative techniques, comprehensive analysis and disease-relevant models have yielded basic and clinical discoveries of conseque...  Read full blog post.
Neurovascular signaling for repair enhances brain metastasis
By Jamshed Arslan, Pharm. D., PhD. Stroke    is a leading cause of mortality and morbidity worldwide. Cellular players – neurons, astrocytes, endothelial and stromal cells – involved in post-stroke repair t...  Read full blog post.
Developmental regulator Daam2 promotes glial cell tumors by degrading Von Hippel-Lindau protein
By Jamshed Arslan Pharm.D. Glioblastoma is an aggressive type of cancer that forms from the star-shaped glial cells of the central nervous system, called astrocytes. Intriguingly, several genes linked to glioblasto...  Read full blog post.
The effects of curcumin on IKB Alpha and the NFkB signaling pathway
The IKK complex, or inhibitor of NFkB kinase, is composed of IKK alpha and IKK beta.  These kinases are at the core of the NFkB signaling cascade.  The NFkB family is made up of transcription factors that are kept inactive in the cytoplasm through...  Read full blog post.
Carbonic anhydrase IX (CAIX) - a reliable histochemical marker of hypoxia
Carbonic anhydrase IX is a member of the carbonic anhydrase family. This family consists of catalytic enzymes capable of converting carbon dioxide and water into carbonic acid, protons, and bicarbonate ions. This family of molecules is abundantly e...  Read full blog post.
CAIX - One of the Best Cellular Markers of Hypoxia
The protein, carbonic anhydrase IX, belongs to the carbonic anhydrase family which consists of enzymes that rapidly convert carbon dioxide and water into the end products of carbonic acid, protons, and bicarbonate ions. These enzymes play a widespread...  Read full blog post.
Getting SHIP-shape Over Tumour Suppression
PTEN antibodies have shown PTEN to be an important tumor suppressor and, in mutated form, a factor in cancer development. However, a recent study, led by Robert Rickert, shows that the SHIP gene may also be an important tumor suppressor in B-cell lymp...  Read full blog post.
PTEN Antibodies and Cancer Research
Phosphatase and tensin homologue (PTEN) antibodies are important tools for cancer research. PTEN is an important tumor suppressor but, in mutated form, is also expressed in a high number of cancers. We at Novus Biologicals have a wide PTEN antibody da...  Read full blog post.

Customers Who Bought This Also Bought

Flow Cytometry: p53 Antibody (PAb 240) [NB200-103] - An intracellular stain was performed on HeLa cells with p53 (PAb240) NB200-103AF647 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 647.
p53 Antibody (PAb 240) - BSA Free
NB200-103

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our PTEN Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol PTEN