![Western Blot: POU4F3 Antibody (5B8) [H00005459-M01] - Analysis of POU4F3 expression in transfected 293T cell line by POU4F3 monoclonal antibody (M01), clone 5B8.Lane 1: POU4F3 transfected lysate(37.1 KDa).Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/POU4F3-Antibody-5B8-Western-Blot-H00005459-M01-img0011.jpg "Western Blot: POU4F3 Antibody (5B8) [H00005459-M01] - Analysis of POU4F3 expression in transfected 293T cell line by POU4F3 monoclonal antibody (M01), clone 5B8.Lane 1: POU4F3 transfected lysate(37.1 KDa).Lane 2: Non-transfected lysate.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ELISA, ICC/IF, KD |
| Clone | 5B8 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Description | Quality control test: Antibody Reactive Against Recombinant Protein. |
| Immunogen | POU4F3 (NP_002691, 100 a.a. ~ 190 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PAALTSHPHHAVHQGLEGDLLEHISPTLSVSGLGAPEHSVMPAQIHPHHLGAMGHLHQAMGMSHPHTVAPHSAMPACLSDVESDPRELEAF |
| Specificity | POU4F3 - POU domain, class 4, transcription factor 3 |
| Isotype | IgG1 Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | POU4F3 |
| Purity | IgG purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF, RNAi Validation and ELISA. |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | IgG purified |
![Western Blot SOX2 Antibody [Unconjugated]](https://images.novusbio.com/images2/SOX2_AF2018_Western_Blot_5161.jpg)
![Chromatin Immunoprecipitation (ChIP) SOX2 Antibody [Unconjugated]](https://images.novusbio.com/images2/SOX2_AF2018_Chromatin_Immunoprecipitation_11224.jpg)
![Simple Western SOX2 Antibody [Unconjugated]](https://images.novusbio.com/images2/SOX2_AF2018_Simple_Western_16676.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for POU4F3 Antibody (H00005459-M01)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunocytochemistry/Immunofluorescence: POU4F3 Antibody (5B8) [H00005459-M01] - Analysis of monoclonal antibody to POU4F3 on HeLa cell. Antibody concentration 10 ug/ml.](http://images.novusbio.com/fullsize/POU4F3-Antibody-5B8-Immunocytochemistry-Immunofluorescence-H00005459-M01-img0007.jpg "Immunocytochemistry/Immunofluorescence: POU4F3 Antibody (5B8) [H00005459-M01] - Analysis of monoclonal antibody to POU4F3 on HeLa cell. Antibody concentration 10 ug/ml.")
![Western Blot: POU4F3 Antibody (5B8) [H00005459-M01] - Analysis of POU4F3 over-expressed 293 cell line, cotransfected with POU4F3 Validated Chimera RNAi ( Cat # H00005459-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with POU4F3 monoclonal antibody (M01), clone 5B8 (Cat # H00005459-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.](http://images.novusbio.com/fullsize/POU4F3-Antibody-5B8-Western-Blot-H00005459-M01-img0008.jpg "Western Blot: POU4F3 Antibody (5B8) [H00005459-M01] - Analysis of POU4F3 over-expressed 293 cell line, cotransfected with POU4F3 Validated Chimera RNAi ( Cat # H00005459-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with POU4F3 monoclonal antibody (M01), clone 5B8 (Cat # H00005459-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.")
![Western Blot: POU4F3 Antibody (5B8) [H00005459-M01] - POU4F3 monoclonal antibody (M01), clone 5B8 Analysis of POU4F3 expression in Hela S3 NE.](http://images.novusbio.com/fullsize/POU4F3-Antibody-5B8-Western-Blot-H00005459-M01-img0010.jpg "Western Blot: POU4F3 Antibody (5B8) [H00005459-M01] - POU4F3 monoclonal antibody (M01), clone 5B8 Analysis of POU4F3 expression in Hela S3 NE.")
![ELISA: POU4F3 Antibody (5B8) [H00005459-M01] - Detection limit for recombinant GST tagged POU4F3 is approximately 0.1ng/ml as a capture antibody.](http://images.novusbio.com/fullsize/POU4F3-Antibody-5B8-ELISA-H00005459-M01-img0009.jpg "ELISA: POU4F3 Antibody (5B8) [H00005459-M01] - Detection limit for recombinant GST tagged POU4F3 is approximately 0.1ng/ml as a capture antibody.")
![N/A BDNF [HRP]](https://images.novusbio.com/images2/DATA_BDNF_DBD00_ELISA_587.jpg)
![N/A BDNF [HRP]](https://images.novusbio.com/images2/DATA_BDNF_DBD00_ELISA_588.jpg)
![N/A BDNF [HRP]](https://images.novusbio.com/images2/BDNF_DBD00_ELISA_36.jpg)
![NT-3 [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "NT-3 [Unconjugated]")
![Intracellular Staining by Flow Cytometry GFI-1 Antibody [Unconjugated]](https://images.novusbio.com/images2/GFI1_AF3540_Flow_Cytometry_23623.jpg)
![Western Blot GFI-1 Antibody [Unconjugated]](https://images.novusbio.com/images/af3540_human-gfi-1-affinity-purified-polyclonal-ab-41202412394973.jpg)
![Western Blot GFI-1 Antibody [Unconjugated]](https://images.novusbio.com/images/af3540_human-gfi-1-affinity-purified-polyclonal-ab-41202412401266.jpg)
![Western Blot GATA-3 Antibody [Unconjugated]](https://images.novusbio.com/images2/GATA-3_AF2605_Western_Blot_5199.jpg)
![Immunocytochemistry GATA-3 Antibody [Unconjugated]](https://images.novusbio.com/images2/GATA-3_AF2605_Immunocytochemistry_6486.jpg)
![Simple Western GATA-3 Antibody [Unconjugated]](https://images.novusbio.com/images2/GATA3_AF2605_Simple_Western_16988.jpg)
![Flow Cytometry: Mouse IgG1 Kappa Isotype Control (P3.6.2.8.1) [NBP1-43319] - Analysis of Alexa Fluor (R) 700 conjugate of NBP1-43319. Human buffy coat stained with mouse IgG1 Kappa isotype control. Flow cytometry image submitted by a verified customer review.](https://images.novusbio.com/images/Mouse-IgG1-Kappa-Light-Chain-Isotype-Control-P3-6-2-8-1-Flow-Cytometry-NBP1-43319-img0002.jpg "Flow Cytometry: Mouse IgG1 Kappa Isotype Control (P3.6.2.8.1) [NBP1-43319] - Analysis of Alexa Fluor (R) 700 conjugate of NBP1-43319. Human buffy coat stained with mouse IgG1 Kappa isotype control. Flow cytometry image submitted by a verified customer review.")