![Immunohistochemistry-Paraffin: BARHL1 Antibody [NBP1-86513] - Staining of human tonsil shows no positivity in non-germinal center cells as expected.](http://images.novusbio.com/fullsize/BARHL1-Antibody-Immunohistochemistry-Paraffin-NBP1-86513-img0013.jpg "Immunohistochemistry-Paraffin: BARHL1 Antibody [NBP1-86513] - Staining of human tonsil shows no positivity in non-germinal center cells as expected.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: LELSPRSESSSDCSSPASPGRDCLETGTPRPGGASGPGLDSHLQPGQLSAPAQSRTVTSSFLIRDILADCKPLAACAPYSSSGQPAAPEPGGRLAAKAAEDFRDKLDKSGSNASSDSEYKVKEEGDREISSSRDSP |
| Predicted Species | Rat (96%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | BARHL1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. Please note that ICC/IF was reported in PMID 31641054, which used a previous lot that is no longer available. The current lot of this antibody is not validated for use in ICC/IF. Please contact technical services if you have any questions. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | BARHL1 |
![Immunohistochemistry-Paraffin: BARHL1 Antibody [NBP1-86513] - Staining of mouse embryo E14 shows strong nuclear positivity in neuronal cells in developing brain stem and cerebellum.](http://images.novusbio.com/fullsize/BARHL1-Antibody-Immunohistochemistry-Paraffin-NBP1-86513-img0009.jpg "Immunohistochemistry-Paraffin: BARHL1 Antibody [NBP1-86513] - Staining of mouse embryo E14 shows strong nuclear positivity in neuronal cells in developing brain stem and cerebellum.")
![Immunohistochemistry-Paraffin: BARHL1 Antibody [NBP1-86513] - Staining of human cerebellum shows weak nuclear positivity in cells in molecular layer.](http://images.novusbio.com/fullsize/BARHL1-Antibody-Immunohistochemistry-Paraffin-NBP1-86513-img0011.jpg "Immunohistochemistry-Paraffin: BARHL1 Antibody [NBP1-86513] - Staining of human cerebellum shows weak nuclear positivity in cells in molecular layer.")
![Immunohistochemistry-Paraffin: BARHL1 Antibody [NBP1-86513] - Staining of human skeletal muscle shows no positivity in myocytes as expected.](http://images.novusbio.com/fullsize/BARHL1-Antibody-Immunohistochemistry-Paraffin-NBP1-86513-img0012.jpg "Immunohistochemistry-Paraffin: BARHL1 Antibody [NBP1-86513] - Staining of human skeletal muscle shows no positivity in myocytes as expected.")
![N/A BDNF [HRP]](https://images.novusbio.com/images2/DATA_BDNF_DBD00_ELISA_587.jpg)
![N/A BDNF [HRP]](https://images.novusbio.com/images2/DATA_BDNF_DBD00_ELISA_588.jpg)
![N/A BDNF [HRP]](https://images.novusbio.com/images2/BDNF_DBD00_ELISA_36.jpg)
![SDS-PAGE FGF-8 [Unconjugated]](https://images.novusbio.com/images2/FGF-8_423-F8_332.jpg)
![Bioactivity FGF-8 [Unconjugated]](https://images.novusbio.com/images2/FGF8_423F8_1438.jpg)
![Cell Culture FGF-8 [Unconjugated]](https://images.novusbio.com/images/423-f8_recombinant-human-mouse-fgf-8b-protein-cell-culture-1052024145159..jpg)
![Intracellular Staining by Flow Cytometry GFI-1 Antibody [Unconjugated]](https://images.novusbio.com/images2/GFI1_AF3540_Flow_Cytometry_23623.jpg)
![Western Blot GFI-1 Antibody [Unconjugated]](https://images.novusbio.com/images/af3540_human-gfi-1-affinity-purified-polyclonal-ab-41202412394973.jpg)
![Western Blot GFI-1 Antibody [Unconjugated]](https://images.novusbio.com/images/af3540_human-gfi-1-affinity-purified-polyclonal-ab-41202412401266.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")