![Western Blot: Peroxiredoxin 2 Antibody (4E10-2D2) [H00007001-M01] - PRDX2 monoclonal antibody (M01), clone 4E10-2D2 Analysis of PRDX2 expression in Hela.](http://images.novusbio.com/fullsize/Peroxiredoxin-2-Antibody-4E10-2D2-Western-Blot-H00007001-M01-img0011.jpg "Western Blot: Peroxiredoxin 2 Antibody (4E10-2D2) [H00007001-M01] - PRDX2 monoclonal antibody (M01), clone 4E10-2D2 Analysis of PRDX2 expression in Hela.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ELISA, ICC/IF, IHC, KD |
| Clone | 4E10-2D2 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Description | Quality control test: Antibody Reactive Against Recombinant Protein. |
| Immunogen | PRDX2 (AAH00452, 1 a.a. ~ 198 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MASGNARIGKPAPDFKATAVVDGAFKEVKLSDYKGKYVVLFFYPLDFTFVCPTEIIAFSNRAEDFRKLGCEVLGVSVDSQFTHLAWINTPRKEGGLGPLNIPLLADVTRRLSEDYGVLKTDEGIAYRGLFIIDGKGVLRQITVNDLPVGRSVDEALRLVQAFQYTDEHGEVCPAGWKPGSDTIKPNVDDSKEYFSKHN |
| Localization | Cytoplasmic |
| Specificity | PRDX2 - peroxiredoxin 2 |
| Isotype | IgG1 Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | PRDX2 |
| Purity | IgG purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Application Notes | Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF, IHC-P and ELISA. |
|
| Reviewed Applications |
|
|
| Publications |
|
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | IgG purified |
![Flow Cytometry ERMAP Antibody [Unconjugated]](https://images.novusbio.com/images2/ERMAP_AF4928_Flow_Cytometry_11957.jpg)
| Images | Ratings | Applications | Species | Date | Details | ||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
Enlarge |
reviewed by:
Corey . |
WB | Human | 09/26/2013 |
Summary
|
Secondary Antibodies |
Isotype Controls |
Research Areas for Peroxiredoxin 2 Antibody (H00007001-M01)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunocytochemistry/Immunofluorescence: Peroxiredoxin 2 Antibody (4E10-2D2) [H00007001-M01] - Analysis of monoclonal antibody to PRDX2 on HeLa cell. Antibody concentration 10 ug/ml.](http://images.novusbio.com/fullsize/Peroxiredoxin-2-Antibody-4E10-2D2-Immunocytochemistry-Immunofluorescence-H00007001-M01-img0007.jpg "Immunocytochemistry/Immunofluorescence: Peroxiredoxin 2 Antibody (4E10-2D2) [H00007001-M01] - Analysis of monoclonal antibody to PRDX2 on HeLa cell. Antibody concentration 10 ug/ml.")
![Immunohistochemistry-Paraffin: Peroxiredoxin 2 Antibody (4E10-2D2) [H00007001-M01] - Analysis of monoclonal antibody to PRDX2 on formalin-fixed paraffin-embedded human malignant lymphoma, diffuse large B tissue. Antibody concentration 1 ug/ml.](http://images.novusbio.com/fullsize/Peroxiredoxin-2-Antibody-4E10-2D2-Immunohistochemistry-Paraffin-H00007001-M01-img0009.jpg "Immunohistochemistry-Paraffin: Peroxiredoxin 2 Antibody (4E10-2D2) [H00007001-M01] - Analysis of monoclonal antibody to PRDX2 on formalin-fixed paraffin-embedded human malignant lymphoma, diffuse large B tissue. Antibody concentration 1 ug/ml.")
![Western Blot: Peroxiredoxin 2 Antibody (4E10-2D2) [H00007001-M01] - Analysis of PRDX2 expression in transfected 293T cell line by PRDX2 monoclonal antibody (M01), clone 4E10-2D2.Lane 1: PRDX2 transfected lysate(21.9 KDa).Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/Peroxiredoxin-2-Antibody-4E10-2D2-Western-Blot-H00007001-M01-img0012.jpg "Western Blot: Peroxiredoxin 2 Antibody (4E10-2D2) [H00007001-M01] - Analysis of PRDX2 expression in transfected 293T cell line by PRDX2 monoclonal antibody (M01), clone 4E10-2D2.Lane 1: PRDX2 transfected lysate(21.9 KDa).Lane 2: Non-transfected lysate.")
![ELISA: Peroxiredoxin 2 Antibody (4E1.0-2D2) [H00007001-M01] - Peroxiredoxin 2 Antibody (4E10-2D2) [H00007001-M01] - Detection limit for recombinant GST tagged PRDX2 is approximately 1ng/ml as a capture antibody.](http://images.novusbio.com/fullsize/Peroxiredoxin-2-Antibody-4E1-0-2D2-ELISA-H00007001-M01-img0013.jpg "ELISA: Peroxiredoxin 2 Antibody (4E1.0-2D2) [H00007001-M01] - Peroxiredoxin 2 Antibody (4E10-2D2) [H00007001-M01] - Detection limit for recombinant GST tagged PRDX2 is approximately 1ng/ml as a capture antibody.")
![Knockdown Validated: Peroxiredoxin 2 Antibody (4E10-2D2) [H00007001-M01] - PRDX2 knockdown increases PRDX4 protein levels in HeLa cells. HeLa subclones were exposed to 20% or 1% O2 for indicated time. Each WCL was subject to immunoblot assays with the indicated antibodies (PRDX2 H00007001-M01 and PRDX4 NBP1-31435). Image collected and cropped by CiteAb from the following publication (oncotarget.com/abstract/7142), licensed under a CC-BY license.](http://images.novusbio.com/fullsize/Peroxiredoxin-2-Antibody-4E10-2D2-Knockdown-Validated-H00007001-M01-img0014.jpg "Knockdown Validated: Peroxiredoxin 2 Antibody (4E10-2D2) [H00007001-M01] - PRDX2 knockdown increases PRDX4 protein levels in HeLa cells. HeLa subclones were exposed to 20% or 1% O2 for indicated time. Each WCL was subject to immunoblot assays with the indicated antibodies (PRDX2 H00007001-M01 and PRDX4 NBP1-31435). Image collected and cropped by CiteAb from the following publication (oncotarget.com/abstract/7142), licensed under a CC-BY license.")
![Western Blot: Peroxiredoxin 2 Antibody (4E10-2D2) [H00007001-M01] - Expression of PRDX2 or PRDX4 does not affect HIF-1 alpha or HIF-2 alpha protein levelsA. & B. HeLa cells were transfected with EV or vector encoding PRDX2-V5 (A, P2) or PRDX4-V5 (B, P4), & exposed to 20% or 1% O2 for 24 h. WCL was subject to immunoblot assays with antibody against HIF-1 alpha , HIF-2 alpha , V5, or acin. C. HeLa-shSC (sc) & HeLa-shPRDX(2+4) (2+4) cells were exposed to 20% or 1% O2 for 24 h in the presence of doxycycline. WCL was subject to immunoblot assays with antibodies against HIF-1 alpha , HIF-2 alpha , PRDX2, PRDX4, & actin. Image collected & cropped by CiteAb from the following publication (//www.oncotarget.com/lookup/doi/10.18632/oncotarget.7142), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/h00007001-m01_mouse-monoclonal-peroxiredoxin-2-antibody-4e10-2d2-31020241534360.jpg "Western Blot: Peroxiredoxin 2 Antibody (4E10-2D2) [H00007001-M01] - Expression of PRDX2 or PRDX4 does not affect HIF-1 alpha or HIF-2 alpha protein levelsA. & B. HeLa cells were transfected with EV or vector encoding PRDX2-V5 (A, P2) or PRDX4-V5 (B, P4), & exposed to 20% or 1% O2 for 24 h. WCL was subject to immunoblot assays with antibody against HIF-1 alpha , HIF-2 alpha , V5, or acin. C. HeLa-shSC (sc) & HeLa-shPRDX(2+4) (2+4) cells were exposed to 20% or 1% O2 for 24 h in the presence of doxycycline. WCL was subject to immunoblot assays with antibodies against HIF-1 alpha , HIF-2 alpha , PRDX2, PRDX4, & actin. Image collected & cropped by CiteAb from the following publication (//www.oncotarget.com/lookup/doi/10.18632/oncotarget.7142), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![Western Blot: Peroxiredoxin 2 Antibody (4E10-2D2) [H00007001-M01] - PRDX2 knockdown increases PRDX4 protein levels in HeLa cellsHeLa subclones were exposed to 20% or 1% O2 for indicated time. Each WCL was subject to immunoblot assays with the indicated antibodies. SC, scrambled control shRNA. P2, PRDX2 shRNA. Image collected & cropped by CiteAb from the following publication (//www.oncotarget.com/lookup/doi/10.18632/oncotarget.7142), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/h00007001-m01_mouse-monoclonal-peroxiredoxin-2-antibody-4e10-2d2-310202415304247.jpg "Western Blot: Peroxiredoxin 2 Antibody (4E10-2D2) [H00007001-M01] - PRDX2 knockdown increases PRDX4 protein levels in HeLa cellsHeLa subclones were exposed to 20% or 1% O2 for indicated time. Each WCL was subject to immunoblot assays with the indicated antibodies. SC, scrambled control shRNA. P2, PRDX2 shRNA. Image collected & cropped by CiteAb from the following publication (//www.oncotarget.com/lookup/doi/10.18632/oncotarget.7142), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![Western Blot: Peroxiredoxin 2 Antibody (4E10-2D2) [H00007001-M01] - Hypoxia induces the nuclear translocation of PRDX2 & PRDX4HeLa cells were transfected with vector encoding PRDX2-V5 (P2) or PRDX4-V5 (P4), or empty vector (EV), & exposed to 20% or 1% O2 for 48 h. Nuclear & cytosolic fractions were isolated & subject to immunoblot assays with antibodies against HIF-1 alpha , HIF-2 alpha , V5, alpha -tubulin, & histone H3. Image collected & cropped by CiteAb from the following publication (//www.oncotarget.com/lookup/doi/10.18632/oncotarget.7142), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/h00007001-m01_mouse-monoclonal-peroxiredoxin-2-antibody-4e10-2d2-310202415304252.jpg "Western Blot: Peroxiredoxin 2 Antibody (4E10-2D2) [H00007001-M01] - Hypoxia induces the nuclear translocation of PRDX2 & PRDX4HeLa cells were transfected with vector encoding PRDX2-V5 (P2) or PRDX4-V5 (P4), or empty vector (EV), & exposed to 20% or 1% O2 for 48 h. Nuclear & cytosolic fractions were isolated & subject to immunoblot assays with antibodies against HIF-1 alpha , HIF-2 alpha , V5, alpha -tubulin, & histone H3. Image collected & cropped by CiteAb from the following publication (//www.oncotarget.com/lookup/doi/10.18632/oncotarget.7142), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![Western Blot: Peroxiredoxin 2 Antibody (4E10-2D2) [H00007001-M01] - Mapping the PRDX2 & PRDX4 binding domains of HIF-1 alpha A. & B. HeLa cells were transfected with PRDX2-V5 (A) or PRDX4-V5 (B) vector & WCL was incubated with purified GST or GST-HIF-1 alpha fusion protein in the presence of glutathione-Sepharose beads, followed by immunoblot assays with anti-V5 antibody (upper panels) or Ponceau S staining (lower panels). Image collected & cropped by CiteAb from the following publication (//www.oncotarget.com/lookup/doi/10.18632/oncotarget.7142), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/h00007001-m01_mouse-monoclonal-peroxiredoxin-2-antibody-4e10-2d2-31020241534389.jpg "Western Blot: Peroxiredoxin 2 Antibody (4E10-2D2) [H00007001-M01] - Mapping the PRDX2 & PRDX4 binding domains of HIF-1 alpha A. & B. HeLa cells were transfected with PRDX2-V5 (A) or PRDX4-V5 (B) vector & WCL was incubated with purified GST or GST-HIF-1 alpha fusion protein in the presence of glutathione-Sepharose beads, followed by immunoblot assays with anti-V5 antibody (upper panels) or Ponceau S staining (lower panels). Image collected & cropped by CiteAb from the following publication (//www.oncotarget.com/lookup/doi/10.18632/oncotarget.7142), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![Western Blot: Peroxiredoxin 2 Antibody (4E10-2D2) [H00007001-M01] - Expression of PRDX2 or PRDX4 does not affect HIF-1 alpha or HIF-2 alpha protein levelsA. & B. HeLa cells were transfected with EV or vector encoding PRDX2-V5 (A, P2) or PRDX4-V5 (B, P4), & exposed to 20% or 1% O2 for 24 h. WCL was subject to immunoblot assays with antibody against HIF-1 alpha , HIF-2 alpha , V5, or acin. C. HeLa-shSC (sc) & HeLa-shPRDX(2+4) (2+4) cells were exposed to 20% or 1% O2 for 24 h in the presence of doxycycline. WCL was subject to immunoblot assays with antibodies against HIF-1 alpha , HIF-2 alpha , PRDX2, PRDX4, & actin. Image collected & cropped by CiteAb from the following publication (//www.oncotarget.com/lookup/doi/10.18632/oncotarget.7142), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/h00007001-m01_mouse-monoclonal-peroxiredoxin-2-antibody-4e10-2d2-310202415175220.jpg "Western Blot: Peroxiredoxin 2 Antibody (4E10-2D2) [H00007001-M01] - Expression of PRDX2 or PRDX4 does not affect HIF-1 alpha or HIF-2 alpha protein levelsA. & B. HeLa cells were transfected with EV or vector encoding PRDX2-V5 (A, P2) or PRDX4-V5 (B, P4), & exposed to 20% or 1% O2 for 24 h. WCL was subject to immunoblot assays with antibody against HIF-1 alpha , HIF-2 alpha , V5, or acin. C. HeLa-shSC (sc) & HeLa-shPRDX(2+4) (2+4) cells were exposed to 20% or 1% O2 for 24 h in the presence of doxycycline. WCL was subject to immunoblot assays with antibodies against HIF-1 alpha , HIF-2 alpha , PRDX2, PRDX4, & actin. Image collected & cropped by CiteAb from the following publication (//www.oncotarget.com/lookup/doi/10.18632/oncotarget.7142), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![Western Blot: Peroxiredoxin 2 Antibody (4E10-2D2) [H00007001-M01] - Effect of PRDX2 & PRDX4 on HIF-1 alpha -p300 interactionHeLa cells were transfected with empty vector (EV) or vector encoding PRDX2-V5 or PRDX4-V5, & exposed to 1% O2 for 24 h. WCL was subject to IP with anti-p300 antibody, followed by immunoblot assays using antibodies against HIF-1 alpha , V5, & p300. Image collected & cropped by CiteAb from the following publication (//www.oncotarget.com/lookup/doi/10.18632/oncotarget.7142), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/h00007001-m01_mouse-monoclonal-peroxiredoxin-2-antibody-4e10-2d2-310202415392540.jpg "Western Blot: Peroxiredoxin 2 Antibody (4E10-2D2) [H00007001-M01] - Effect of PRDX2 & PRDX4 on HIF-1 alpha -p300 interactionHeLa cells were transfected with empty vector (EV) or vector encoding PRDX2-V5 or PRDX4-V5, & exposed to 1% O2 for 24 h. WCL was subject to IP with anti-p300 antibody, followed by immunoblot assays using antibodies against HIF-1 alpha , V5, & p300. Image collected & cropped by CiteAb from the following publication (//www.oncotarget.com/lookup/doi/10.18632/oncotarget.7142), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![Western Blot: Peroxiredoxin 2 Antibody (4E10-2D2) [H00007001-M01] - PRDX2 expression is regulated by HIF-1 & HIF-2A. HeLa cells were exposed to 20% or 1% O2 for 24 h. RT-qPCR assays were performed using primers specific for the indicated mRNAs. Data are shown as mean ± SEM, n = 3. ***p < 0.001 versus 20% O2. B. HeLa cells were exposed to 20% or 1% O2 for the indicated time. WCLs were subject to immunoblot assays with antibodies against PRDX2, HIF-1 alpha , HIF-2 alpha , & actin. The PRDX2 & actin bands were quantified by densitometry & normalized to 0 h (20% O2). Normalized data are shown as mean ± SEM, n = 3. *p < 0.05, ***p < 0.001 versus 20% O2. C. HeLa-shSC (SC), HeLa-shHIF-1 alpha (1 alpha ), HeLa-shHIF-2 alpha (2 alpha ), & HeLa-sh1 alpha +2 alpha (DKD) cells were exposed to 20% or 1% O2 for 72 h. WCLs were subject to immunoblot assays with antibodies against PRDX2, HIF-1 alpha , HIF-2 alpha , & actin. Image collected & cropped by CiteAb from the following publication (//www.oncotarget.com/lookup/doi/10.18632/oncotarget.7142), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/h00007001-m01_mouse-monoclonal-peroxiredoxin-2-antibody-4e10-2d2-310202415482276.jpg "Western Blot: Peroxiredoxin 2 Antibody (4E10-2D2) [H00007001-M01] - PRDX2 expression is regulated by HIF-1 & HIF-2A. HeLa cells were exposed to 20% or 1% O2 for 24 h. RT-qPCR assays were performed using primers specific for the indicated mRNAs. Data are shown as mean ± SEM, n = 3. ***p < 0.001 versus 20% O2. B. HeLa cells were exposed to 20% or 1% O2 for the indicated time. WCLs were subject to immunoblot assays with antibodies against PRDX2, HIF-1 alpha , HIF-2 alpha , & actin. The PRDX2 & actin bands were quantified by densitometry & normalized to 0 h (20% O2). Normalized data are shown as mean ± SEM, n = 3. *p < 0.05, ***p < 0.001 versus 20% O2. C. HeLa-shSC (SC), HeLa-shHIF-1 alpha (1 alpha ), HeLa-shHIF-2 alpha (2 alpha ), & HeLa-sh1 alpha +2 alpha (DKD) cells were exposed to 20% or 1% O2 for 72 h. WCLs were subject to immunoblot assays with antibodies against PRDX2, HIF-1 alpha , HIF-2 alpha , & actin. Image collected & cropped by CiteAb from the following publication (//www.oncotarget.com/lookup/doi/10.18632/oncotarget.7142), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![Western Blot: Peroxiredoxin 2 Antibody (4E10-2D2) [H00007001-M01] - PRDX proteins bind to HIF-1 alpha & HIF-2 alpha A. HeLa cells were transfected with an expression vector encoding V5-epitope-tagged PRDX2 (PRDX2-V5) & exposed to 1% O2 for 24 h. Whole cell lysate (WCL) was subject to immunoprecipitation (IP) using anti-HIF-1 alpha antibody or control IgG, followed by immunoblot assays with antibody against V5 epitope or HIF-1 alpha . B. HeLa cells were transfected with PRDX2-V5 vector & exposed to 1% O2 for 24 h. The WCL was subject to IP using anti-V5 antibody or control IgG, followed by immunoblot assays with antibody against V5 or HIF-1 alpha . Light IgG: immunoglobulin light chain from the secondary antibody. C. HeLa cells were transfected with vector encoding a V5-tagged PRDX family member & exposed to 1% O2 for 24 h. WCL was subject to IP using anti-HIF-1 alpha antibody, followed by immunoblot assays with antibody against V5 or HIF-1 alpha . D. HeLa cells were transfected with empty vector (EV) or vector encoding a V5-tagged PRDX family member & exposed to 1% O2 for 24 h. WCL was subject to IP using anti-HIF-2 alpha antibody, followed by immunoblot assays with antibody against V5 or HIF-2 alpha . Image collected & cropped by CiteAb from the following publication (//www.oncotarget.com/lookup/doi/10.18632/oncotarget.7142), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/h00007001-m01_mouse-monoclonal-peroxiredoxin-2-antibody-4e10-2d2-310202415482298.jpg "Western Blot: Peroxiredoxin 2 Antibody (4E10-2D2) [H00007001-M01] - PRDX proteins bind to HIF-1 alpha & HIF-2 alpha A. HeLa cells were transfected with an expression vector encoding V5-epitope-tagged PRDX2 (PRDX2-V5) & exposed to 1% O2 for 24 h. Whole cell lysate (WCL) was subject to immunoprecipitation (IP) using anti-HIF-1 alpha antibody or control IgG, followed by immunoblot assays with antibody against V5 epitope or HIF-1 alpha . B. HeLa cells were transfected with PRDX2-V5 vector & exposed to 1% O2 for 24 h. The WCL was subject to IP using anti-V5 antibody or control IgG, followed by immunoblot assays with antibody against V5 or HIF-1 alpha . Light IgG: immunoglobulin light chain from the secondary antibody. C. HeLa cells were transfected with vector encoding a V5-tagged PRDX family member & exposed to 1% O2 for 24 h. WCL was subject to IP using anti-HIF-1 alpha antibody, followed by immunoblot assays with antibody against V5 or HIF-1 alpha . D. HeLa cells were transfected with empty vector (EV) or vector encoding a V5-tagged PRDX family member & exposed to 1% O2 for 24 h. WCL was subject to IP using anti-HIF-2 alpha antibody, followed by immunoblot assays with antibody against V5 or HIF-2 alpha . Image collected & cropped by CiteAb from the following publication (//www.oncotarget.com/lookup/doi/10.18632/oncotarget.7142), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![Western Blot: Peroxiredoxin 2 Antibody (4E10-2D2) [H00007001-M01] - PRDX proteins bind to HIF-1 alpha & HIF-2 alpha A. HeLa cells were transfected with an expression vector encoding V5-epitope-tagged PRDX2 (PRDX2-V5) & exposed to 1% O2 for 24 h. Whole cell lysate (WCL) was subject to immunoprecipitation (IP) using anti-HIF-1 alpha antibody or control IgG, followed by immunoblot assays with antibody against V5 epitope or HIF-1 alpha . B. HeLa cells were transfected with PRDX2-V5 vector & exposed to 1% O2 for 24 h. The WCL was subject to IP using anti-V5 antibody or control IgG, followed by immunoblot assays with antibody against V5 or HIF-1 alpha . Light IgG: immunoglobulin light chain from the secondary antibody. C. HeLa cells were transfected with vector encoding a V5-tagged PRDX family member & exposed to 1% O2 for 24 h. WCL was subject to IP using anti-HIF-1 alpha antibody, followed by immunoblot assays with antibody against V5 or HIF-1 alpha . D. HeLa cells were transfected with empty vector (EV) or vector encoding a V5-tagged PRDX family member & exposed to 1% O2 for 24 h. WCL was subject to IP using anti-HIF-2 alpha antibody, followed by immunoblot assays with antibody against V5 or HIF-2 alpha . Image collected & cropped by CiteAb from the following publication (//www.oncotarget.com/lookup/doi/10.18632/oncotarget.7142), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/h00007001-m01_mouse-monoclonal-peroxiredoxin-2-antibody-4e10-2d2-310202415485134.jpg "Western Blot: Peroxiredoxin 2 Antibody (4E10-2D2) [H00007001-M01] - PRDX proteins bind to HIF-1 alpha & HIF-2 alpha A. HeLa cells were transfected with an expression vector encoding V5-epitope-tagged PRDX2 (PRDX2-V5) & exposed to 1% O2 for 24 h. Whole cell lysate (WCL) was subject to immunoprecipitation (IP) using anti-HIF-1 alpha antibody or control IgG, followed by immunoblot assays with antibody against V5 epitope or HIF-1 alpha . B. HeLa cells were transfected with PRDX2-V5 vector & exposed to 1% O2 for 24 h. The WCL was subject to IP using anti-V5 antibody or control IgG, followed by immunoblot assays with antibody against V5 or HIF-1 alpha . Light IgG: immunoglobulin light chain from the secondary antibody. C. HeLa cells were transfected with vector encoding a V5-tagged PRDX family member & exposed to 1% O2 for 24 h. WCL was subject to IP using anti-HIF-1 alpha antibody, followed by immunoblot assays with antibody against V5 or HIF-1 alpha . D. HeLa cells were transfected with empty vector (EV) or vector encoding a V5-tagged PRDX family member & exposed to 1% O2 for 24 h. WCL was subject to IP using anti-HIF-2 alpha antibody, followed by immunoblot assays with antibody against V5 or HIF-2 alpha . Image collected & cropped by CiteAb from the following publication (//www.oncotarget.com/lookup/doi/10.18632/oncotarget.7142), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![Western Blot: Peroxiredoxin 2 Antibody (4E10-2D2) [H00007001-M01] - PRDX2 expression is regulated by HIF-1 & HIF-2A. HeLa cells were exposed to 20% or 1% O2 for 24 h. RT-qPCR assays were performed using primers specific for the indicated mRNAs. Data are shown as mean ± SEM, n = 3. ***p < 0.001 versus 20% O2. B. HeLa cells were exposed to 20% or 1% O2 for the indicated time. WCLs were subject to immunoblot assays with antibodies against PRDX2, HIF-1 alpha , HIF-2 alpha , & actin. The PRDX2 & actin bands were quantified by densitometry & normalized to 0 h (20% O2). Normalized data are shown as mean ± SEM, n = 3. *p < 0.05, ***p < 0.001 versus 20% O2. C. HeLa-shSC (SC), HeLa-shHIF-1 alpha (1 alpha ), HeLa-shHIF-2 alpha (2 alpha ), & HeLa-sh1 alpha +2 alpha (DKD) cells were exposed to 20% or 1% O2 for 72 h. WCLs were subject to immunoblot assays with antibodies against PRDX2, HIF-1 alpha , HIF-2 alpha , & actin. Image collected & cropped by CiteAb from the following publication (//www.oncotarget.com/lookup/doi/10.18632/oncotarget.7142), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/h00007001-m01_mouse-monoclonal-peroxiredoxin-2-antibody-4e10-2d2-31020241548364.jpg "Western Blot: Peroxiredoxin 2 Antibody (4E10-2D2) [H00007001-M01] - PRDX2 expression is regulated by HIF-1 & HIF-2A. HeLa cells were exposed to 20% or 1% O2 for 24 h. RT-qPCR assays were performed using primers specific for the indicated mRNAs. Data are shown as mean ± SEM, n = 3. ***p < 0.001 versus 20% O2. B. HeLa cells were exposed to 20% or 1% O2 for the indicated time. WCLs were subject to immunoblot assays with antibodies against PRDX2, HIF-1 alpha , HIF-2 alpha , & actin. The PRDX2 & actin bands were quantified by densitometry & normalized to 0 h (20% O2). Normalized data are shown as mean ± SEM, n = 3. *p < 0.05, ***p < 0.001 versus 20% O2. C. HeLa-shSC (SC), HeLa-shHIF-1 alpha (1 alpha ), HeLa-shHIF-2 alpha (2 alpha ), & HeLa-sh1 alpha +2 alpha (DKD) cells were exposed to 20% or 1% O2 for 72 h. WCLs were subject to immunoblot assays with antibodies against PRDX2, HIF-1 alpha , HIF-2 alpha , & actin. Image collected & cropped by CiteAb from the following publication (//www.oncotarget.com/lookup/doi/10.18632/oncotarget.7142), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![N/A VEGF [HRP]](https://images.novusbio.com/images2/DATA_VEGF_DVE00_ELISA_871.jpg)
![N/A VEGF [HRP]](https://images.novusbio.com/images2/DATA_VEGF_DVE00_ELISA_872.jpg)
![N/A VEGF [HRP]](https://images.novusbio.com/images2/VEGF_DVE00_ELISA_208.jpg)
![Immunocytochemistry Caspase-3 Antibody [Unconjugated] - Active](https://images.novusbio.com/images2/Caspase-3_AF835_Immunocytochemistry_6532.jpg)
![Immunohistochemistry Caspase-3 Antibody [Unconjugated] - Active](https://images.novusbio.com/images2/Caspase3_AF835_Immunohistochemistry_22976.jpg)
![Immunocytochemistry Caspase-3 Antibody [Unconjugated] - Active](https://images.novusbio.com/images2/Caspase-3_AF835_Immunocytochemistry_9340.jpg)
![Flow Cytometry: Mouse IgG1 Kappa Isotype Control (P3.6.2.8.1) [NBP1-43319] - Analysis of Alexa Fluor (R) 700 conjugate of NBP1-43319. Human buffy coat stained with mouse IgG1 Kappa isotype control. Flow cytometry image submitted by a verified customer review.](https://images.novusbio.com/images/Mouse-IgG1-Kappa-Light-Chain-Isotype-Control-P3-6-2-8-1-Flow-Cytometry-NBP1-43319-img0002.jpg "Flow Cytometry: Mouse IgG1 Kappa Isotype Control (P3.6.2.8.1) [NBP1-43319] - Analysis of Alexa Fluor (R) 700 conjugate of NBP1-43319. Human buffy coat stained with mouse IgG1 Kappa isotype control. Flow cytometry image submitted by a verified customer review.")
