PCMT1 Antibody Summary
Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 62-286 of human PCMT1 (NP_001238978.1).
Sequence: KSGGASHSELIHNLRKNGIIKTDKVFEVMLATDRSHYAKCNPYMDSPQSIGFQATISAPHMHAYALELLFDQLHEGAKALDVGSGSGILTACFARMVGCTGKVIGIDHIKELVDDSVNNVRKDDPTLLSSGRVQLVVGDGRMGYAEEAPYDAIHVGAAAPVVPQALIDQLKPGGRLILPVGPAGGNQMLEQYDKLQDGSIKMKPLMGVIYVPLTDKEKQWSRDEL |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
PCMT1 |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- ELISA
- Immunocytochemistry/ Immunofluorescence 1:50 - 1:100
- Immunoprecipitation 0.5ug - 4ug antibody for 200ug - 400ug extracts of whole cells
- Western Blot 1:500 - 1:2000
|
Theoretical MW |
25 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
Storage |
Store at -20C. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.3), 50% glycerol |
Preservative |
0.02% Sodium Azide |
Purity |
Affinity purified |
Alternate Names for PCMT1 Antibody
Background
Three classes of protein carboxyl methyltransferases, distinguished by their methyl-acceptor substrate specificity, have been found in prokaryotic and eukaryotic cells. The type II enzyme catalyzes the transfer of a methyl group from S-adenosyl-L-methionine to the free carboxyl groups of D-aspartyl and L-isoaspartyl residues. These methyl-accepting residues result from the spontaneous deamidation, isomerization, and racemization of normal L-aspartyl and L-asparaginyl residues and represent sites of covalent damage to aging proteins PCMT1 (EC 2.1.1.77) is a protein repair enzyme that initiates the conversion of abnormal D-aspartyl and L-isoaspartyl residues to the normal L-aspartyl form.[supplied by OMIM]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: IHC, IHC-P, IP, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, IP, WB
Species: Hu, Mu
Applications: WB
Species: Av, Bv, Sh
Applications: WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Species: Hu, Po
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
Species: Ch
Applications: ELISA, IHC, Single-Cell Western, WB
Species: Hu
Applications: ICC
Species: Hu
Applications: BA
Species: Hu
Applications: Simple Western, WB
Species: Hu, Mu
Applications: WB
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Species: Hu
Applications: ELISA, ICC/IF, IP, WB
Species: Hu, Mu, Rt
Applications: ICC, WB
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IP
Publications for PCMT1 Antibody (NBP3-38309) (0)
There are no publications for PCMT1 Antibody (NBP3-38309).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for PCMT1 Antibody (NBP3-38309) (0)
There are no reviews for PCMT1 Antibody (NBP3-38309).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for PCMT1 Antibody (NBP3-38309) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional PCMT1 Products
Blogs on PCMT1