![Immunohistochemistry-Paraffin: Phospholipase C like 1 Antibody [NBP1-80896] - Staining of human lung shows weak to moderate cytoplasmic positivity in pneumocytes and in macrophages.](http://images.novusbio.com/fullsize/Phospholipase-C-like-1-Antibody-Immunohistochemistry-Paraffin-NBP1-80896-img0009.jpg "Immunohistochemistry-Paraffin: Phospholipase C like 1 Antibody [NBP1-80896] - Staining of human lung shows weak to moderate cytoplasmic positivity in pneumocytes and in macrophages.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: LRYLVSRSKQPLDFMEGNQNTPRFMWLKTVFEAADVDGNGIMLEDTSVELIKQLNPTLKEAKIRLKFKEIQKSKEKLTTRVTEEEF |
| Predicted Species | Mouse (98%), Rat (99%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | PLCL1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Immunocytochemistry Polycystin-1/PKD1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Polycystin1_AF6270_Immunocytochemistry__Immunofluorescence_20130.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for Phospholipase C like 1 Antibody (NBP1-80896)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry-Paraffin: Phospholipase C like 1 Antibody [NBP1-80896] - Staining of human cerebellum shows moderate cytoplasmic positivity in purkinje cells.](http://images.novusbio.com/fullsize/Phospholipase-C-like-1-Antibody-Immunohistochemistry-Paraffin-NBP1-80896-img0006.jpg "Immunohistochemistry-Paraffin: Phospholipase C like 1 Antibody [NBP1-80896] - Staining of human cerebellum shows moderate cytoplasmic positivity in purkinje cells.")
![Immunohistochemistry-Paraffin: Phospholipase C like 1 Antibody [NBP1-80896] - Staining of human heart muscle shows moderate cytoplasmic positivity.](http://images.novusbio.com/fullsize/Phospholipase-C-like-1-Antibody-Immunohistochemistry-Paraffin-NBP1-80896-img0007.jpg "Immunohistochemistry-Paraffin: Phospholipase C like 1 Antibody [NBP1-80896] - Staining of human heart muscle shows moderate cytoplasmic positivity.")
![Immunohistochemistry-Paraffin: Phospholipase C like 1 Antibody [NBP1-80896] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.](http://images.novusbio.com/fullsize/Phospholipase-C-like-1-Antibody-Immunohistochemistry-Paraffin-NBP1-80896-img0008.jpg "Immunohistochemistry-Paraffin: Phospholipase C like 1 Antibody [NBP1-80896] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.")
![Immunohistochemistry-Paraffin: Phospholipase C like 1 Antibody [NBP1-80896] - Staining in human kidney and lung tissues . Corresponding PLCL1 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/Phospholipase-C-like-1-Antibody-Immunohistochemistry-Paraffin-NBP1-80896-img0010.jpg "Immunohistochemistry-Paraffin: Phospholipase C like 1 Antibody [NBP1-80896] - Staining in human kidney and lung tissues . Corresponding PLCL1 RNA-seq data are presented for the same tissues.")
![N/A CXCL7/NAP-2 [Biotin]](https://images.novusbio.com/images2/DATA_CXCL7_DY393_ELISA_1991.jpg)
![Simple Western PAG1 Antibody (504004) [Unconjugated]](https://images.novusbio.com/images2/PAG1_MAB5285_Simple_Western_16616.jpg)
![Western Blot PAG1 Antibody (504004) [Unconjugated]](https://images.novusbio.com/images2/PAG1_MAB5285_Western_Blot_9455.jpg)
![Western Blot CBP/KAT3A Antibody (257003) [Unconjugated]](https://images.novusbio.com/images2/CBP_MAB2676_Western_Blot_6043.jpg)
![Immunocytochemistry CBP/KAT3A Antibody (257003) [Unconjugated]](https://images.novusbio.com/images2/mab2676_human-mouse-rat-cbp-mab-clone-257003-immunocytochemistry-101220208237.jpg)
![Western Blot eIF4E [p Ser209] Antibody](https://images.novusbio.com/images/eIF4E-[p-Ser209]-Antibody-Western-Blot-NB100-81898-img0009.jpg)
![Immunocytochemistry/ Immunofluorescence eIF4E [p Ser209] Antibody](https://images.novusbio.com/images/eIF4E-[p-Ser209]-Antibody-Immunocytochemistry-Immunofluorescence-NB100-81898-img0005.jpg)
![Immunohistochemistry-Paraffin eIF4E [p Ser209] Antibody](https://images.novusbio.com/images/eIF4E-[p-Ser209]-Antibody-Immunohistochemistry-NB100-81898-img0006.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")