Novus Biologicals products are now on bio-techne.com

Nucleolin Recombinant Protein Antigen

Images

 
There are currently no images for Nucleolin Recombinant Protein Antigen (NBP3-21345PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Nucleolin Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Nucleolin

Source: E.coli

Amino Acid Sequence: LEKPKGKDSKKERDARTLLAKNLPYKVTQDELKEVFEDAAEIRLVSKDGKSKGIAYIEFKTEADAEKTFEEKQGTEIDGRSISLYY

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
NCL
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-21345. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Nucleolin Recombinant Protein Antigen

  • C23
  • FLJ45706
  • FLJ59041
  • nucleolin
  • Protein C23

Background

Nucleolin is an abundant, 106 kDa nucleolar phosphoprotein. It is the major protein in actively dividing cells, whereas the degraded forms are relatively abundant in non-dividing cells. Stability of the nucleolin protein is cell proliferation-dependent. It plays a role in rDNA transcription, organization, and rRNA processing. It may alter DNA organization in response to cell cycle controls. Nucleolin antibodies are commonly used as a mammalian nucleolus marker.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-61646
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
NBP2-45388
Species: Hu
Applications: IHC, IHC-P, WB
NB300-269
Species: Bv, Ce, Ch, Dr, Eq, Hu, Mu, Pl, Po, Rt, Y, Ye
Applications: Flow, ICC/IF, IHC-WhMt, IHC, IHC-Fr, IHC-P, KD, WB
NBP2-48820
Species: Hu
Applications: IHC, IHC-P
NBP2-43782
Species: Hu
Applications: WB
NBP2-92342
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-39066
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-92707
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP1-85729
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP2-29463
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
AF1029
Species: Mu
Applications: ICC, IHC, IP, WB
NBP1-82545
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP3-38210
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NB600-302
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, S-ELISA, Simple Western, WB
NB100-56098
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
NBP2-33466
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP3-21345PEP
Species: Hu
Applications: AC

Publications for Nucleolin Recombinant Protein Antigen (NBP3-21345PEP) (0)

There are no publications for Nucleolin Recombinant Protein Antigen (NBP3-21345PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Nucleolin Recombinant Protein Antigen (NBP3-21345PEP) (0)

There are no reviews for Nucleolin Recombinant Protein Antigen (NBP3-21345PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Nucleolin Recombinant Protein Antigen (NBP3-21345PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Nucleolin Products

Research Areas for Nucleolin Recombinant Protein Antigen (NBP3-21345PEP)

Find related products by research area.

Blogs on Nucleolin.

Nucleolin: A Multifaceted Nucleolar Phosphoprotein
Nucleolin is a ubiquitous, nonhistone nucleolar phosphoprotein of exponentially growing eukaryotic cells and is present in abundance at the dense fibrillar and granular regions of nucleolus. Intact nucleolin is the major species and represents 5% of n...  Read full blog post.

Nucleolin Antibodies: Knowing When it's Time to Split
Nucleolin is an abundant, 106 kDa nucleolar phosphoprotein that is a major protein in actively dividing cells. The stability of nucleolin is heavily cell proliferation-dependent, as nucleolin antibody studies have shown that degraded forms are relativ...  Read full blog post.

Nucleolin: To the Nucleus and Beyond!
Nucleolin is a multifunctional phosphoprotein ubiquitously distributed in the nucleolus, nucleus and cytoplasm of the cell. Nucleolin has a bipartite nuclear localization signal sequence and is conserved across the species. Nucleolin levels are expres...  Read full blog post.

Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Nucleolin Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol NCL