![Immunohistochemistry-Paraffin: Tripeptidyl-Peptidase I/TPP1 Antibody [NBP2-48820] - Staining of human kidney.](http://images.novusbio.com/fullsize/Tripeptidyl-Peptidase-I-TPP1-Antibody-Immunohistochemistry-Paraffin-NBP2-48820-img0007.jpg "Immunohistochemistry-Paraffin: Tripeptidyl-Peptidase I/TPP1 Antibody [NBP2-48820] - Staining of human kidney.")
| Reactivity | HuSpecies Glossary |
| Applications | IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: SSLRQRPEPQVTGTVGLHLGVTPSVIRKRYNLTSQDVGSGTSNNSQACAQFLEQYFHDSDLAQFMRLFGGNFAHQASVARVV |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | TPP1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for Tripeptidyl-Peptidase I/TPP1 Antibody (NBP2-48820)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | TPP1 |
![Immunohistochemistry: Tripeptidyl-Peptidase I/TPP1 Antibody [NBP2-48820] - Staining of human heart muscle shows strong granular cytoplasmic positivity in myocytes.](http://images.novusbio.com/fullsize/Tripeptidyl-Peptidase-I-TPP1-Antibody-Immunohistochemistry-NBP2-48820-img0001.jpg "Immunohistochemistry: Tripeptidyl-Peptidase I/TPP1 Antibody [NBP2-48820] - Staining of human heart muscle shows strong granular cytoplasmic positivity in myocytes.")
![Immunohistochemistry: Tripeptidyl-Peptidase I/TPP1 Antibody [NBP2-48820] - Staining of human adrenal gland shows high expression.](http://images.novusbio.com/fullsize/Tripeptidyl-Peptidase-I-TPP1-Antibody-Immunohistochemistry-NBP2-48820-img0002.jpg "Immunohistochemistry: Tripeptidyl-Peptidase I/TPP1 Antibody [NBP2-48820] - Staining of human adrenal gland shows high expression.")
![Immunohistochemistry-Paraffin: Tripeptidyl-Peptidase I/TPP1 Antibody [NBP2-48820] - Staining of human skeletal muscle shows low expression as expected.](http://images.novusbio.com/fullsize/Tripeptidyl-Peptidase-I-TPP1-Antibody-Immunohistochemistry-Paraffin-NBP2-48820-img0003.jpg "Immunohistochemistry-Paraffin: Tripeptidyl-Peptidase I/TPP1 Antibody [NBP2-48820] - Staining of human skeletal muscle shows low expression as expected.")
![Immunohistochemistry-Paraffin: Tripeptidyl-Peptidase I/TPP1 Antibody [NBP2-48820] - Staining in human adrenal gland and skeletal muscle tissues using anti-TPP1 antibody. Corresponding TPP1 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/Tripeptidyl-Peptidase-I-TPP1-Antibody-Immunohistochemistry-Paraffin-NBP2-48820-img0004.jpg "Immunohistochemistry-Paraffin: Tripeptidyl-Peptidase I/TPP1 Antibody [NBP2-48820] - Staining in human adrenal gland and skeletal muscle tissues using anti-TPP1 antibody. Corresponding TPP1 RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: Tripeptidyl-Peptidase I/TPP1 Antibody [NBP2-48820] - Staining of human adrenal gland, kidney, skeletal muscle and testis using Anti-TPP1 antibody NBP2-48820 (A) shows similar protein distribution across tissues to independent antibody NBP1-85561 (B).](http://images.novusbio.com/fullsize/Tripeptidyl-Peptidase-I-TPP1-Antibody-Immunohistochemistry-Paraffin-NBP2-48820-img0005.jpg "Immunohistochemistry-Paraffin: Tripeptidyl-Peptidase I/TPP1 Antibody [NBP2-48820] - Staining of human adrenal gland, kidney, skeletal muscle and testis using Anti-TPP1 antibody NBP2-48820 (A) shows similar protein distribution across tissues to independent antibody NBP1-85561 (B).")
![Immunohistochemistry-Paraffin: Tripeptidyl-Peptidase I/TPP1 Antibody [NBP2-48820] - Staining of human testis.](http://images.novusbio.com/fullsize/Tripeptidyl-Peptidase-I-TPP1-Antibody-Immunohistochemistry-Paraffin-NBP2-48820-img0006.jpg "Immunohistochemistry-Paraffin: Tripeptidyl-Peptidase I/TPP1 Antibody [NBP2-48820] - Staining of human testis.")
![Immunohistochemistry Cathepsin D Antibody [Unconjugated]](https://images.novusbio.com/images2/Cathepsin_D_AF1029_Immunohistochemistry_6668.jpg)
![Immunocytochemistry Cathepsin D Antibody [Unconjugated]](https://images.novusbio.com/images2/Cathepsin_D_AF1029_Immunocytochemistry__Immunofluorescence_23054.jpg)
![Western Blot Cathepsin D Antibody [Unconjugated]](https://images.novusbio.com/images2/Cathepsin_D_AF1029_Western_Blot_19580.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")