Reactivity | HuSpecies Glossary |
Applications | ICC/IF |
Clonality | Polyclonal |
Host | Rabbit |
Conjugate | Unconjugated |
Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: DPEGQSQQVGAPGLQAPQGLPEAIEPLVEDDVAPGGDQASPEVMLGSEPAMGESAAGAEPGPGQGVGGLGDPGHLTREEVMEPPLEEESLEAKRVQGLEGPRKDLEEAGGLGTEFSELP |
Isotype | IgG |
Clonality | Polyclonal |
Host | Rabbit |
Gene | NES |
Purity | Affinity purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
Application Notes | ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100. |
Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer | PBS (pH 7.2) and 40% Glycerol |
Preservative | 0.02% Sodium Azide |
Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for Nestin Antibody (NBP2-58884)Find related products by research area.
|
Deriving neural precursor cells from human induced pluripotent stem cells By Jennifer Sokolowski, MD, PhD.Human induced pluripotent stem cells (iPSCs) can be used to create models of human organ systems and are useful for a) ascertaining the mechanisms underlying pathological conditions... Read full blog post. |
Nestin: Investigating the Link Between New Brain Cells and Depression Clinical depression (also known as major depressive disorder or MDD) affects many people, but the biological processes that cause it (and are influenced by its treatments) are not well understood. Adult neurogenesis is a newly emerging field that coul... Read full blog post. |
Nestin Antibody Products in Neuronal Cancer Research Nestin is a large class Vl intermediate filament protein predominantly expressed in the neuroepithelial stem cells of the embryonic central nervous system, although recent nestin antibody studies have shown it expressed in other cell types, including ... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
Gene Symbol | NES |