LSD1 Antibody (7R10X6) Summary
Additional Information |
Recombinant Monoclonal Antibody |
Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 700-811 of human LSD1 (NP_055828.2). APILLALVAGEAAGIMENISDDVIVGRCLAILKGIFGSSAVPQPKETVVSRWRADPWARGSYSYVAAGSSGNDYDLMAQPITPGPSIPGAPQPIPRLFFAGEHTIRNYPATV |
Isotype |
IgG |
Clonality |
Monoclonal |
Host |
Rabbit |
Gene |
KDM1A |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunohistochemistry 1:50 - 1:200
- Immunohistochemistry-Paraffin
- Western Blot 1:500 - 1:1000
|
Packaging, Storage & Formulations
Storage |
Store at -20C. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.3), 50% glycerol, 0.05% BSA |
Preservative |
0.02% Sodium Azide |
Purity |
Affinity purified |
Alternate Names for LSD1 Antibody (7R10X6)
Background
LSD1 a recently identified, first known lysine-specific histone demethylase, is an 886 amino acid nuclear protein belonging to flavin monoamine oxidase family. It contains a SWIRM domain, a FAD-binding motif and an amine oxidase domain. This protein is ubiquitously expressed and is a component of several histone deacetylase complexes. LSD1 acts as a component of the CoREST and other transcriptional co-repressor complexes and also plays an important role in silencing neuronal-specific genes in non-neuronal cells. It is also known to demethylate Lys-4 of histone H3, a specific tag for epigenetic transcriptional activation. Reports suggest that it plays an important role in stimulating androgen-receptor-dependent transcription converting oxygen to hydrogen peroxide (might use alternative electron acceptors). Along with nuclear FHL2 it serves as a novel biomarker predictive for prostate cancer.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, I, Mu, Rt, Xp, Ye
Applications: ChIP, IB, ICC/IF, IHC, IHC-P, Single-Cell Western, WB
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
Species: Hu, Mu, Rt
Applications: ChIP, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, KO, Simple Western, WB
Species: Hu, Mu
Applications: ChIP, IHC, IHC-P, WB
Species: Bv, Hu, Mu, Po, Rt, Sh
Applications: ChIP, CyTOF-ready, Flow-IC, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, KD, Simple Western, WB
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Bv, Ca, Hu, Mu, Pm
Applications: WB
Species: Hu, Mu
Applications: ICC/IF, IP, WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Pm, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
Species: Av, Ca, Hu, Ma, Mu, Pm, Rt, Ze
Applications: ChIP, ChIP, Flow, IB, ICC/IF, IHC, IHC-P, IP, KD, KO, RNAi, Simple Western, WB
Species: Hu
Applications: IHC, WB
Species: Hu, Mu
Applications: ChIP, ICC, IP, Simple Western, WB
Species: Hu, Mu
Applications: ChIP, ChIP, ICC/IF, IHC, IHC-P, IP, KD, Simple Western, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: DirELISA, IP, WB
Species: Hu
Applications: WB
Publications for LSD1 Antibody (NBP3-16688) (0)
There are no publications for LSD1 Antibody (NBP3-16688).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for LSD1 Antibody (NBP3-16688) (0)
There are no reviews for LSD1 Antibody (NBP3-16688).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for LSD1 Antibody (NBP3-16688) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional LSD1 Products
Research Areas for LSD1 Antibody (NBP3-16688)
Find related products by research area.
|
Blogs on LSD1