Reactivity | Hu, MuSpecies Glossary |
Applications | WB, ELISA |
Clone | 4E10 |
Clonality | Monoclonal |
Host | Mouse |
Conjugate | Unconjugated |
Immunogen | KLF1 (NP_006554, 183 a.a. ~ 237 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PRTGLSVPAASGAPYGLLSGYPAMYPAPQYQGHFQLFRGLQGPAPGPATSPSFLS |
Specificity | KLF1 (4E10) |
Isotype | IgG3 Kappa |
Clonality | Monoclonal |
Host | Mouse |
Gene | KLF1 |
Purity | IgG purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
|
Application Notes | Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA. |
|
Publications |
|
Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
Buffer | In 1x PBS, pH 7.4 |
Preservative | No Preservative |
Purity | IgG purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for KLF1 Antibody (H00010661-M02)Find related products by research area.
|
KLF4 as a transcription factor in stem cell differentiation Kru¨ppel-like factors (KLFs) are evolutionarily conserved zinc finger transcription factors that play a role in cell differentiation, proliferation, and pluripotency. KLF4 has specifically been tied to many diverse cellular processes, including sel... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.