![Western Blot: KLF3 Antibody [NBP2-48937] - Analysis in human cell line K562.](http://images.novusbio.com/fullsize/KLF3-Antibody-Western-Blot-NBP2-48937-img0005.jpg "Western Blot: KLF3 Antibody [NBP2-48937] - Analysis in human cell line K562.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: SYEKPISQKKIKIEPGIEPQRTDYYPEEMSPPLMNSVSPPQALLQENHPSVIVQPGKRPLPVESPDTQRKR |
| Predicted Species | Mouse (96%), Rat (99%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | KLF3 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for KLF3 Antibody (NBP2-48937)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | KLF3 |
![Immunocytochemistry/Immunofluorescence: KLF3 Antibody [NBP2-48937] - Staining of human cell line A-431 shows localization to nucleoplasm.](http://images.novusbio.com/fullsize/KLF3-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-48937-img0003.jpg "Immunocytochemistry/Immunofluorescence: KLF3 Antibody [NBP2-48937] - Staining of human cell line A-431 shows localization to nucleoplasm.")
![Immunohistochemistry-Paraffin: KLF3 Antibody [NBP2-48937] - Staining of human skin shows strong nuclear positivity in squamous epithelial cells.](http://images.novusbio.com/fullsize/KLF3-Antibody-Immunohistochemistry-Paraffin-NBP2-48937-img0009.jpg "Immunohistochemistry-Paraffin: KLF3 Antibody [NBP2-48937] - Staining of human skin shows strong nuclear positivity in squamous epithelial cells.")
![Immunohistochemistry-Paraffin: KLF3 Antibody [NBP2-48937] - Staining of human colon shows strong nuclear positivity in glandular cells.](http://images.novusbio.com/fullsize/KLF3-Antibody-Immunohistochemistry-Paraffin-NBP2-48937-img0006.jpg "Immunohistochemistry-Paraffin: KLF3 Antibody [NBP2-48937] - Staining of human colon shows strong nuclear positivity in glandular cells.")
![Immunohistochemistry-Paraffin: KLF3 Antibody [NBP2-48937] - Staining of human colorectal cancer shows strong nuclear positivity in tumor cells.](http://images.novusbio.com/fullsize/KLF3-Antibody-Immunohistochemistry-Paraffin-NBP2-48937-img0007.jpg "Immunohistochemistry-Paraffin: KLF3 Antibody [NBP2-48937] - Staining of human colorectal cancer shows strong nuclear positivity in tumor cells.")
![Immunohistochemistry-Paraffin: KLF3 Antibody [NBP2-48937] - Staining of human prostate shows moderate nuclear positivity in glandular cells.](http://images.novusbio.com/fullsize/KLF3-Antibody-Immunohistochemistry-Paraffin-NBP2-48937-img0008.jpg "Immunohistochemistry-Paraffin: KLF3 Antibody [NBP2-48937] - Staining of human prostate shows moderate nuclear positivity in glandular cells.")
![COCO/DAND5 [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "COCO/DAND5 [Unconjugated]")
![N/A PSG1 [HRP]](https://images.novusbio.com/images2/DATA_PSG1_DPSG10_ELISA_797.jpg)
![N/A PSG1 [HRP]](https://images.novusbio.com/images2/PSG-1_DPSG10_ELISA_164.jpg)
![Immunohistochemistry TFF2 Antibody (366508) [Unconjugated]](https://images.novusbio.com/images2/TFF2_MAB4077_Immunohistochemistry_21485.jpg)
![Immunocytochemistry EGR1 Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af2818_human-egr1-affinity-purified-polyclonal-ab-immunocytochemistry-3102024831..jpg)
![Chromatin Immunoprecipitation (ChIP) KLF4 Antibody [Unconjugated]](https://images.novusbio.com/images2/KLF4_AF3158_Chromatin_Immunoprecipitation_11234.jpg)
![Immunocytochemistry KLF4 Antibody [Unconjugated]](https://images.novusbio.com/images2/KLF4_AF3158_Immunocytochemistry_7262.jpg)
![Immunohistochemistry KLF4 Antibody [Unconjugated]](https://images.novusbio.com/images2/KLF4_AF3158_Immunohistochemistry_24135.jpg)
![Simple Western KLF5 Antibody [Unconjugated]](https://images.novusbio.com/images2/KLF5_AF3758_Simple_Western_17008.jpg)
![Knockout Validated KLF5 Antibody [Unconjugated]](https://images.novusbio.com/images2/KLF5_AF3758_Knockout_Validated_22484.jpg)
![Immunocytochemistry KLF5 Antibody [Unconjugated]](https://images.novusbio.com/images2/KLF5_AF3758_Immunocytochemistry_12361.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images2/DATA_IL6_M6000_ELISA_936.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images2/IL-6_M6000_ELISA_415.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images/m6000b_mouse-il-6-quantikine-elisa-kit-44202415433118.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")