Home » IkB-alpha » IkB-alpha Proteins » IkB-alpha Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

IkB-alpha Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for IkB-alpha Protein (NBP1-87761PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

IkB-alpha Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human NFKBIA.

Source: E. coli

Amino Acid Sequence: MFQAAERPQEWAMEGPRDGLKKERLLDDRHDSGLDSMKDEEYEQMVKELQEIRLEPQEVPRGSEPWKQQLTEDGDSFLHLAIIHEEKALTMEVIRQVKGDLAFLNFQNNLQQTPLHLAVITNQPEIAEALLGAGCDPELRDFRG

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
NFKBIA
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-87761.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
34 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for IkB-alpha Recombinant Protein Antigen

  • alpha
  • I-kappa-B-alpha
  • IkappaBalphaNF-kappa-B inhibitor alpha
  • IKBAikB-alpha
  • IkBalpha
  • IkB-alpha
  • MAD3
  • MAD-3
  • Major histocompatibility complex enhancer-binding protein MAD3
  • NFKBI
  • NFKBIA
  • nuclear factor of kappa light chain gene enhancer in B-cells
  • nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor

Background

NF-kB is silenced in the cytoplasm by an inhibitory protein, IkB (1). Synthesis of IkBa is autoregulated (2). IkB proteins are phosphorylated by IkB kinase complex consisting of at least three proteins, IKK1/a, IKK2/b, and IKK3/g (3-6). External stimuli such as tumor necrosis factor or other cytokines results in phosphorylation and degradation of IkB releasing NF-kB dimers. NF-kB dimer subsequently translocates to the nucleus and activates target genes. Six members of IkB family members have been identified (1). One of the first gene induced following NF-kB activation is IkBa.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NFkB p105/p50
Antibody (2J10D7) - B ...
NB100-56583
Flow Cytometry NFkB p105/p50 Antibody (2J10D7) - BSA Free
Flow Cytometry NFkB p105/p50 Antibody (2J10D7) - BSA Free
Flow Cytometry NFkB p105/p50 Antibody (2J10D7) - BSA Free
(1 Review)
(5 Publications)
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, WB
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(818 Publications)
Species: Hu
Applications: BA
Human, Mouse, Rat
RelA/NFkB p65 ELISA K ...
NBP2-29661
ELISA Human, Mouse, Rat RelA/NFkB p65 ELISA Kit (Colorimetric)
ELISA Human, Mouse, Rat RelA/NFkB p65 ELISA Kit (Colorimetric)
ELISA Human, Mouse, Rat RelA/NFkB p65 ELISA Kit (Colorimetric)
(95 Publications)
Species: Hu, Mu, Rt
Applications: ELISA
Synaptotagmin 1
Antibody (ASV48) [Unc ...
MAB4364
Immunocytochemistry Synaptotagmin 1 Antibody (ASV48) [Unconjugated]
Immunohistochemistry Synaptotagmin 1 Antibody (ASV48) [Unconjugated]
Immunocytochemistry Synaptotagmin 1 Antibody (ASV48) [Unconjugated]
(2 Publications)
Species: Rt
Applications: ICC, IHC, IP, KO, WB
WNK1 Antibody
[Unconjugated]
AF2849
Western Blot WNK1 Antibody [Unconjugated]
(5 Publications)
Species: Mu, Rt
Applications: WB
GRASP65 Antibody
(OTI5G8)
NBP2-02665
Immunocytochemistry/ Immunofluorescence GRASP65 Antibody (OTI5G8)
Immunocytochemistry/ Immunofluorescence GRASP65 Antibody (OTI5G8)
Flow Cytometry GRASP65 Antibody (OTI5G8)
(3 Reviews)
(2 Publications)
Species: Ca, Hu, Pm, Po, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
IL-6 [HRP]
M6000B
N/A IL-6 [HRP]
N/A IL-6 [HRP]
N/A IL-6 [HRP]
(667 Publications)
Species: Mu
Applications: ELISA
c-jun [p Ser63]
Antibody (1018Y) [Unc ...
MAB8930
Western Blot c-jun [p Ser63] Antibody (1018Y) [Unconjugated]
Immunocytochemistry c-jun [p Ser63] Antibody (1018Y) [Unconjugated]
Simple Western c-jun [p Ser63] Antibody (1018Y) [Unconjugated]
(1 Review)
(3 Publications)
Species: Hu
Applications: ICC, Simple Western, WB
CD40/TNFRSF5
Antibody [Unconjugate
AF632
Agonist Activity CD40/TNFRSF5 Antibody [Unconjugated]
Western Blot CD40/TNFRSF5 Antibody [Unconjugated]
Simple Western CD40/TNFRSF5 Antibody [Unconjugated]
(7 Publications)
Species: Hu
Applications: AgAct, Simple Western, WB
ERK2 Antibody
[Unconjugated]
AF1230
Western Blot ERK2 Antibody [Unconjugated]
Immunohistochemistry ERK2 Antibody [Unconjugated]
Knockout Validated ERK2 Antibody [Unconjugated]
(3 Publications)
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
iNOS Antibody -
BSA Free
NB300-605
Western Blot iNOS Antibody - BSA Free
Western Blot iNOS Antibody - BSA Free
Western Blot iNOS Antibody - BSA Free
(3 Reviews)
(130 Publications)
Species: Hu, Mu, Po, Rt
Applications: Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, WB
ARHGEF7 Antibody
NBP1-88650
Western Blot ARHGEF7 Antibody
Immunohistochemistry-Paraffin ARHGEF7 Antibody
Immunohistochemistry-Paraffin ARHGEF7 Antibody
Species: Hu
Applications: IHC, IHC-P, KD, WB
ASCC1 Antibody
(OTI6G5)
NBP2-01345
Flow Cytometry ASCC1 Antibody (OTI6G5)
Flow Cytometry ASCC1 Antibody (OTI6G5)
Western Blot ASCC1 Antibody (OTI6G5)
(1 Review)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
IKK beta Antibody
(10AG2) - BSA Free
NB100-56509
Flow Cytometry IKK beta Antibody (10AG2) - BSA Free
Immunocytochemistry/ Immunofluorescence IKK beta Antibody (10AG2) - BSA Free
Flow Cytometry IKK beta Antibody (10AG2) - BSA Free
(2 Reviews)
(60 Publications)
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, IB, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
IKK alpha Antibody
(14A231) - BSA Free
NB100-56704
Immunocytochemistry/ Immunofluorescence IKK alpha Antibody (14A231) - BSA Free
Immunocytochemistry/ Immunofluorescence IKK alpha Antibody (14A231) - BSA Free
Immunohistochemistry-Paraffin IKK alpha Antibody (14A231) - BSA Free
(85 Publications)
Species: Hu, Mu, Pm, Rt
Applications: ChIP, ChIP, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
COX-2 Antibody
NB100-689
Immunohistochemistry-Paraffin COX-2 Antibody
Simple Western COX-2 Antibody
(1 Review)
(36 Publications)
Species: Hu, Rt
Applications: IHC, IHC-Fr, IHC-P, Simple Western, WB
AKT [p Ser473]
Antibody [Unconjugate ...
AF887
Western Blot AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
Simple Western AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
Intracellular Staining by Flow Cytometry AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
(50 Publications)
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
c-Rel Antibody
[Unconjugated]
AF2699
Simple Western c-Rel Antibody [Unconjugated]
Western Blot c-Rel Antibody [Unconjugated]
(1 Review)
(3 Publications)
Species: Mu
Applications: Simple Western, WB
IKK epsilon/IKBKE
Antibody (346909) [Un ...
MAB3199
Immunocytochemistry IKK epsilon/IKBKE Antibody (346909) [Unconjugated]
Western Blot IKK epsilon/IKBKE Antibody (346909) [Unconjugated]
Immunocytochemistry IKK epsilon/IKBKE Antibody (346909) [Unconjugated]
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC, WB
IkB-alpha
Recombinant Protein A
NBP1-87761PEP
IkB-alpha Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for IkB-alpha Protein (NBP1-87761PEP) (0)

There are no publications for IkB-alpha Protein (NBP1-87761PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IkB-alpha Protein (NBP1-87761PEP) (0)

There are no reviews for IkB-alpha Protein (NBP1-87761PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for IkB-alpha Protein (NBP1-87761PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional IkB-alpha Products

Research Areas for IkB-alpha Protein (NBP1-87761PEP)

Find related products by research area.

Blogs on IkB-alpha.

Check out the latest blog posts on IkB-alpha.
Sample collection from mammalian culture cells for kinomic analysis
By Jamshed Arslan Pharm.D., PhD.IntroductionKinome describes kinases, and kinomics refers to the kinase signaling. Studying the effects of reagent (exogenously applied growth factor or inhibitor) on kinase activit...  Read full blog post.
The effects of curcumin on IKB Alpha and the NFkB signaling pathway
The IKK complex, or inhibitor of NFkB kinase, is composed of IKK alpha and IKK beta.  These kinases are at the core of the NFkB signaling cascade.  The NFkB family is made up of transcription factors that are kept inactive in the cytoplasm through...  Read full blog post.
Inhibitor kappa B-alpha (IkappaB-alpha)
The transcription factor nuclear factor kappa beta (NFkB) is highly regulated by triggers such as stress, free-radicals, UV light, and hypoxia. NFkB is one of the fastest responding transcription factors in humans. The NFKB signaling pathway is ess...  Read full blog post.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our IkB-alpha Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol NFKBIA