![Immunocytochemistry/ Immunofluorescence: Histone H4 [ac Lys5] Antibody (10G1L0) [NBP3-33198] - Immunofluorescence analysis of NIH-3T3 cells using Histone H4 Rabbit mAb.NIH-3T3 cells were treated by TSA (1 uM) at 37C for 18 hours(left). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/nbp3-33198_rabbit-histone-h4-ac-lys5-mab-10g1l0-912202414163061.jpg "Immunocytochemistry/ Immunofluorescence: Histone H4 [ac Lys5] Antibody (10G1L0) [NBP3-33198] - Immunofluorescence analysis of NIH-3T3 cells using Histone H4 Rabbit mAb.NIH-3T3 cells were treated by TSA (1 uM) at 37C for 18 hours(left). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, DB, ELISA, ICC/IF, IHC |
| Clone | 10G1L0 |
| Clonality | Monoclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | A synthetic acetylated peptide around K5 of human H4 Clustered Histone 1 (P62805). Sequence: MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYG |
| Modification | ac Lys5 |
| Isotype | IgG |
| Clonality | Monoclonal |
| Host | Rabbit |
| Gene | H4C1 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Theoretical MW | 11 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.3), 50% glycerol, 0.05% BSA |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
|
H4 - Monitoring global chromatin structure through histone modifications Histones make up the main protein component of chromatin and are responsible for storing and organizing the genome in a compact yet accessible manner. In addition to storage, histones play an important role in the regulation of various cellular pro... Read full blog post. |
|
Histone H4 Phosphorylation: Affecting Liver Regeneration and Cancer Histones are highly conserved proteins that function in the organization of nuclear DNA to create chromatin in eukaryotic cells. Post-translational alterations of histones are critical to monitoring and regulating DNA structure, expression, and gene t... Read full blog post. |
|
Histone H4: Implications in Liver Cancer Histones are highly conserved proteins that function in the organization of nuclear DNA to create chromatin in eukaryotic cells. Post-translational alterations of histones are critical to monitoring and regulating DNA structure, expression, and gene t... Read full blog post. |
|
"Come Fly with Me" - New Drosophila Model Developed for Direct in Vivo Study of Histones Forming the major protein component of chromatin, histones are essential to the structure and organization of chromosomes, forming the nucleosome around which DNA is packaged and wrapped.Antibody studies have revealed histones undergo various posttr... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | H4C1 |
![Western Blot: Histone H4 [ac Lys5] Antibody (10G1L0) [NBP3-33198] - Western blot analysis of various lysates using Histone H4 Rabbit mAb at 1:1000 dilution. HeLa cells and NIH/3T3 cells and C6 cells were treated by TSA (1 uM) at 37C for 18 hours.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 10s.](http://images.novusbio.com/fullsize/nbp3-33198_rabbit-histone-h4-ac-lys5-mab-10g1l0-912202415133460.jpg "Western Blot: Histone H4 [ac Lys5] Antibody (10G1L0) [NBP3-33198] - Western blot analysis of various lysates using Histone H4 Rabbit mAb at 1:1000 dilution. HeLa cells and NIH/3T3 cells and C6 cells were treated by TSA (1 uM) at 37C for 18 hours.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 10s.")
![Dot Blot: Histone H4 [ac Lys5] Antibody (10G1L0) [NBP3-33198] - Dot-blot analysis of all sorts of peptides using Histone H4 antibody at 1:1000 dilution.](http://images.novusbio.com/fullsize/nbp3-33198_rabbit-histone-h4-ac-lys5-mab-10g1l0-912202415143619.jpg "Dot Blot: Histone H4 [ac Lys5] Antibody (10G1L0) [NBP3-33198] - Dot-blot analysis of all sorts of peptides using Histone H4 antibody at 1:1000 dilution.")
![Immunohistochemistry: Histone H4 [ac Lys5] Antibody (10G1L0) [NBP3-33198] - Immunohistochemistry analysis of paraffin-embedded Rat brain using Histone H4 Rabbit mAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.](http://images.novusbio.com/fullsize/nbp3-33198_rabbit-histone-h4-ac-lys5-mab-10g1l0-91220241418156.jpg "Immunohistochemistry: Histone H4 [ac Lys5] Antibody (10G1L0) [NBP3-33198] - Immunohistochemistry analysis of paraffin-embedded Rat brain using Histone H4 Rabbit mAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.")
![Immunohistochemistry: Histone H4 [ac Lys5] Antibody (10G1L0) [NBP3-33198] - Immunohistochemistry analysis of paraffin-embedded Human appendix using Histone H4 Rabbit mAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.](http://images.novusbio.com/fullsize/nbp3-33198_rabbit-histone-h4-ac-lys5-mab-10g1l0-912202414101813.jpg "Immunohistochemistry: Histone H4 [ac Lys5] Antibody (10G1L0) [NBP3-33198] - Immunohistochemistry analysis of paraffin-embedded Human appendix using Histone H4 Rabbit mAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.")
![Immunohistochemistry: Histone H4 [ac Lys5] Antibody (10G1L0) [NBP3-33198] - Immunohistochemistry analysis of paraffin-embedded Mouse kidney using Histone H4 Rabbit mAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.](http://images.novusbio.com/fullsize/nbp3-33198_rabbit-histone-h4-ac-lys5-mab-10g1l0-912202415133440.jpg "Immunohistochemistry: Histone H4 [ac Lys5] Antibody (10G1L0) [NBP3-33198] - Immunohistochemistry analysis of paraffin-embedded Mouse kidney using Histone H4 Rabbit mAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.")
![Immunocytochemistry/ Immunofluorescence: Histone H4 [ac Lys5] Antibody (10G1L0) [NBP3-33198] - Immunofluorescence analysis of U-2 OS cells using Histone H4 Rabbit mAb.U-2 OS cells were treated by TSA (1 uM) at 37C for 18 hours(left). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/nbp3-33198_rabbit-histone-h4-ac-lys5-mab-10g1l0-912202414123824.jpg "Immunocytochemistry/ Immunofluorescence: Histone H4 [ac Lys5] Antibody (10G1L0) [NBP3-33198] - Immunofluorescence analysis of U-2 OS cells using Histone H4 Rabbit mAb.U-2 OS cells were treated by TSA (1 uM) at 37C for 18 hours(left). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.")
![Immunocytochemistry/ Immunofluorescence: Histone H4 [ac Lys5] Antibody (10G1L0) [NBP3-33198] - Immunofluorescence analysis of C6 cells using Histone H4 Rabbit mAb.C6 cells were treated by TSA (1 uM) at 37C for 18 hours(left). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/nbp3-33198_rabbit-histone-h4-ac-lys5-mab-10g1l0-912202414163036.jpg "Immunocytochemistry/ Immunofluorescence: Histone H4 [ac Lys5] Antibody (10G1L0) [NBP3-33198] - Immunofluorescence analysis of C6 cells using Histone H4 Rabbit mAb.C6 cells were treated by TSA (1 uM) at 37C for 18 hours(left). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.")
![Western Blot CBP/KAT3A Antibody (257003) [Unconjugated]](https://images.novusbio.com/images2/CBP_MAB2676_Western_Blot_6043.jpg)
![Immunocytochemistry CBP/KAT3A Antibody (257003) [Unconjugated]](https://images.novusbio.com/images2/mab2676_human-mouse-rat-cbp-mab-clone-257003-immunocytochemistry-101220208237.jpg)
![Western Blot eIF4E [p Ser209] Antibody](https://images.novusbio.com/images/eIF4E-[p-Ser209]-Antibody-Western-Blot-NB100-81898-img0009.jpg)
![Immunocytochemistry/ Immunofluorescence eIF4E [p Ser209] Antibody](https://images.novusbio.com/images/eIF4E-[p-Ser209]-Antibody-Immunocytochemistry-Immunofluorescence-NB100-81898-img0005.jpg)
![Immunohistochemistry-Paraffin eIF4E [p Ser209] Antibody](https://images.novusbio.com/images/eIF4E-[p-Ser209]-Antibody-Immunohistochemistry-NB100-81898-img0006.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")