Reactivity | Hu, Mu, RtSpecies Glossary |
Applications | WB, DB, ELISA, ICC/IF, IHC |
Clone | 10G1L0 |
Clonality | Monoclonal |
Host | Rabbit |
Conjugate | Unconjugated |
Immunogen | A synthetic acetylated peptide around K5 of human H4 Clustered Histone 1 (P62805). Sequence: MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYG |
Modification | ac Lys5 |
Isotype | IgG |
Clonality | Monoclonal |
Host | Rabbit |
Gene | H4C1 |
Purity | Affinity purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
Theoretical MW | 11 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Storage | Store at -20C. Avoid freeze-thaw cycles. |
Buffer | PBS (pH 7.3), 50% glycerol, 0.05% BSA |
Preservative | 0.02% Sodium Azide |
Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
H4 - Monitoring global chromatin structure through histone modifications Histones make up the main protein component of chromatin and are responsible for storing and organizing the genome in a compact yet accessible manner. In addition to storage, histones play an important role in the regulation of various cellular pro... Read full blog post. |
Histone H4 Phosphorylation: Affecting Liver Regeneration and Cancer Histones are highly conserved proteins that function in the organization of nuclear DNA to create chromatin in eukaryotic cells. Post-translational alterations of histones are critical to monitoring and regulating DNA structure, expression, and gene t... Read full blog post. |
Histone H4: Implications in Liver Cancer Histones are highly conserved proteins that function in the organization of nuclear DNA to create chromatin in eukaryotic cells. Post-translational alterations of histones are critical to monitoring and regulating DNA structure, expression, and gene t... Read full blog post. |
"Come Fly with Me" - New Drosophila Model Developed for Direct in Vivo Study of Histones Forming the major protein component of chromatin, histones are essential to the structure and organization of chromosomes, forming the nucleosome around which DNA is packaged and wrapped.Antibody studies have revealed histones undergo various posttr... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
Gene Symbol | H4C1 |