Home » Histone Deacetylase 4/HDAC4 » Histone Deacetylase 4/HDAC4 Proteins » Histone Deacetylase 4/HDAC4 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

Histone Deacetylase 4/HDAC4 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for Histone Deacetylase 4/HDAC4 Recombinant Protein Antigen (NBP2-58297PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Histone Deacetylase 4/HDAC4 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Histone Deacetylase 4/HDAC4.

Source: E. coli

Amino Acid Sequence: QDAERLTLPALQQRLSLFPGTHLTPYLSTSPLERDGGAAHSPLLQHMVLLEQPPAQAPLVTGLGALPLHAQSLVGADRVSPSIHKL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
HDAC4
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-58297.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Histone Deacetylase 4/HDAC4 Recombinant Protein Antigen

  • HA6116
  • HD4EC 3.5.1.98
  • HDAC4
  • HDAC-A
  • HDACABDMR
  • Histone Deacetylase 4
  • histone deacetylase A
  • KIAA0288AHO3

Background

Chromatin is a highly specialized structure composed of tightly compacted chromosomal DNA. Gene expression within the nucleus is controlled, in part, by a host of protein complexes which continuously pack and unpack the chromosomal DNA. One of the known mechanisms of this packing and unpacking process involves the acetylation and deacetylation of the histone proteins comprising the nucleosomal core. Acetylated histone proteins confer accessibility of the DNA template to the transcriptional machinery for expression. Histone deacetylases (HDACs) are chromatin remodeling factors that deacetylate histone proteins and thus, may act as transcriptional repressors. HDACs are classified by their sequence homology to the yeast HDACs and there are currently 2 classes. Class I proteins are related to Rpd3 and members of class II resemble Hda1p.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

HDAC9 Antibody -
BSA Free
NBP2-03993
Western Blot HDAC9 Antibody - BSA Free
(1 Review)
(1 Publication)
Species: Bv, Ca, Hu, Mu, Pm
Applications: WB
HDAC5 Antibody -
BSA Free
NBP2-22152
Immunocytochemistry/ Immunofluorescence HDAC5 Antibody - BSA Free
Immunohistochemistry HDAC5 Antibody - BSA Free
Western Blot HDAC5 Antibody - BSA Free
(1 Review)
(5 Publications)
Species: Hu, Mu, Pm, Rt
Applications: ChIP, ChIP, ICC/IF, IHC, IHC-P, WB
MEF2A Antibody
(1C8)
H00004205-M15
Western Blot MEF2A Antibody (1C8)
ELISA MEF2A Antibody (1C8)
Immunocytochemistry/ Immunofluorescence MEF2A Antibody (1C8)
(1 Review)
Species: Hu
Applications: ELISA, ICC/IF, WB
HDAC1 Antibody
NB100-56340
Knockout Validated HDAC1 Antibody
Simple Western HDAC1 Antibody
Western Blot HDAC1 Antibody
(2 Reviews)
(19 Publications)
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, KO, Simple Western, WB
HDAC3 Antibody
NB100-1669
Immunocytochemistry/ Immunofluorescence HDAC3 Antibody
Immunocytochemistry/ Immunofluorescence HDAC3 Antibody
Simple Western HDAC3 Antibody
(9 Publications)
Species: Hu
Applications: ChIP, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
Histone
Deacetylase 2/HDAC2 A
NBP1-87109
Immunocytochemistry/ Immunofluorescence Histone Deacetylase 2/HDAC2 Antibody
Western Blot Histone Deacetylase 2/HDAC2 Antibody
Immunohistochemistry-Paraffin Histone Deacetylase 2/HDAC2 Antibody
(1 Publication)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, KD, WB
HDAC7 Antibody
NBP1-44092
Western Blot HDAC7 Antibody
(1 Review)
Species: Hu, Mu, Pm, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
p21/CIP1/CDKN1A
Antibody (WA-1)
NBP2-29463
Immunohistochemistry-Paraffin p21/CIP1/CDKN1A Antibody (WA-1)
(24 Publications)
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
RUNX2/CBFA1
Antibody (232902) [Un ...
MAB2006
Immunocytochemistry RUNX2/CBFA1 Antibody (232902) [Unconjugated]
(1 Review)
(28 Publications)
Species: Hu
Applications: ICC
HDAC6 Antibody -
BSA Free
NB100-56343
Immunocytochemistry/ Immunofluorescence HDAC6 Antibody - BSA Free
Simple Western HDAC6 Antibody - BSA Free
Western Blot HDAC6 Antibody - BSA Free
(2 Publications)
Species: Hu, Mu
Applications: ChIP, ChIP, ICC/IF, IP, Simple Western, WB
MEF2C Antibody
(OTI1H5)
NBP2-00493
Flow Cytometry MEF2C Antibody (OTI1H5)
Flow Cytometry MEF2C Antibody (OTI1H5)
Flow Cytometry MEF2C Antibody (OTI1H5)
(3 Publications)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
14-3-3 Antibody
NBP2-27202
Simple Western 14-3-3 Antibody
Immunocytochemistry/ Immunofluorescence 14-3-3 Antibody
Western Blot 14-3-3 Antibody
(1 Review)
Species: Ca, Ch, ChHa, Fe, Hu, Mu, Ma-Op, Po, Pm, Rt
Applications: ICC/IF, Simple Western, WB
NCOR1 Antibody
(7A7A9) - BSA Free
NBP1-28863
Immunohistochemistry-Paraffin NCOR1 Antibody (7A7A9) - BSA Free
Immunohistochemistry NCOR1 Antibody (7A7A9) - BSA Free
Western Blot NCOR1 Antibody (7A7A9) - BSA Free
(3 Publications)
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Peroxiredoxin 2
Antibody (4E10-2D2)
H00007001-M01
ELISA Peroxiredoxin 2 Antibody (4E10-2D2)
Knockdown Validated Peroxiredoxin 2 Antibody (4E10-2D2)
Western Blot Peroxiredoxin 2 Antibody (4E10-2D2)
(1 Review)
(6 Publications)
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, KD, WB
KAT3B/p300
Antibody (RW105) - BS
NB100-616
Immunocytochemistry/ Immunofluorescence KAT3B/p300 Antibody (RW105) - BSA Free
Flow Cytometry KAT3B/p300 Antibody (RW105) - BSA Free
Immunocytochemistry/ Immunofluorescence KAT3B/p300 Antibody (RW105) - BSA Free
(13 Publications)
Species: Hu, Mu, Md, Pm, Rt
Applications: ChIP, EM, Flow-IC, Flow, ICC/IF, IP, In vitro, KD, WB
Histone H3
Antibody - BSA Free
NB500-171
Immunohistochemistry-Paraffin Histone H3 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence Histone H3 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence Histone H3 Antibody - BSA Free
(8 Reviews)
(34 Publications)
Species: Hu, I, Mu, Rt, Xp, Ye
Applications: ChIP, IB, ICC/IF, IHC, IHC-P, Single-Cell Western, WB
Histone
Deacetylase 8/HDAC8 A ...
NBP3-16713
Knockout Validated Histone Deacetylase 8/HDAC8 Antibody (1O2Y5)
Immunohistochemistry-Paraffin Histone Deacetylase 8/HDAC8 Antibody (1O2Y5)
Immunohistochemistry-Paraffin Histone Deacetylase 8/HDAC8 Antibody (1O2Y5)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KO, WB
MEF2D Antibody
NBP1-85788
Immunocytochemistry/ Immunofluorescence MEF2D Antibody
ELISA MEF2D Antibody
Immunohistochemistry-Paraffin MEF2D Antibody
(2 Reviews)
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, Simple Western, WB
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(811 Publications)
Species: Hu
Applications: BA
Histone
Deacetylase 4/HDAC4 R ...
NBP2-58297PEP
Histone Deacetylase 4/HDAC4 Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for Histone Deacetylase 4/HDAC4 Recombinant Protein Antigen (NBP2-58297PEP) (0)

There are no publications for Histone Deacetylase 4/HDAC4 Recombinant Protein Antigen (NBP2-58297PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Histone Deacetylase 4/HDAC4 Recombinant Protein Antigen (NBP2-58297PEP) (0)

There are no reviews for Histone Deacetylase 4/HDAC4 Recombinant Protein Antigen (NBP2-58297PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Histone Deacetylase 4/HDAC4 Recombinant Protein Antigen (NBP2-58297PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Histone Deacetylase 4/HDAC4 Products

Research Areas for Histone Deacetylase 4/HDAC4 Recombinant Protein Antigen (NBP2-58297PEP)

Find related products by research area.

Blogs on Histone Deacetylase 4/HDAC4

There are no specific blogs for Histone Deacetylase 4/HDAC4, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005
Immunohistochemistry-Paraffin: Histone H3 Antibody [NB500-171] - Immunoperoxidase staining of Anti-Histone H3 in FFPE mouse testis.
Histone H3 Antibody - BSA Free
NB500-171

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Histone Deacetylase 4/HDAC4 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol HDAC4