![Western Blot: HABP1/C1QBP/GC1q R Antibody [NBP1-89790] - Analysis in human cell lines HEK293 and U2OS using Anti-C1QBP antibody. Corresponding C1QBP RNA-seq data are presented for the same cell lines. Loading control: Anti-HSP90B1.](http://images.novusbio.com/fullsize/HABP1-C1QBP-GC1q-R-Antibody-Western-Blot-NBP1-89790-img0017.jpg "Western Blot: HABP1/C1QBP/GC1q R Antibody [NBP1-89790] - Analysis in human cell lines HEK293 and U2OS using Anti-C1QBP antibody. Corresponding C1QBP RNA-seq data are presented for the same cell lines. Loading control: Anti-HSP90B1.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: GGWELELNGTEAKLVRKVAGEKITVTFNINNSIPPTFDGEEEPSQGQKVEEQEPELTSTPNFVVEVIKNDDGKKALVLDCHY |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | C1QBP |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation/Permeabilization: PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Simple Western CD44 Antibody (2C5) [Unconjugated] - s Pan Specific](https://images.novusbio.com/images2/CD44_BBA10_Simple_Western_21377.jpg)
![Western Blot CD44 Antibody (2C5) [Unconjugated] - s Pan Specific](https://images.novusbio.com/images2/CD44_BBA10_Western_Blot_21459.jpg)
![Immunohistochemistry CD44 Antibody (2C5) [Unconjugated] - s Pan Specific](https://images.novusbio.com/images2/CD44_BBA10_Immunohistochemistry_17361.jpg)
| Publication using NBP1-89790 | Applications | Species |
|---|---|---|
| Matos P, Horn JA, Beards F et al. A role for the mitochondrial-associated protein p32 in regulation of trophoblast proliferation. Mol Hum Reprod 2014-08-01 [PMID: 24874554] (IF/IHC, Human) | IF/IHC | Human |
Secondary Antibodies |
Isotype Controls |
Research Areas for HABP1/C1QBP/GC1q R Antibody (NBP1-89790)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | C1QBP |
![Immunocytochemistry/Immunofluorescence: HABP1/C1QBP/GC1q R Antibody [NBP1-89790] - Immunofluorescent staining of human cell line A-431 shows localization to plasma membrane. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/HABP1-C1QBP-GC1q-R-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-89790-img0011.jpg "Immunocytochemistry/Immunofluorescence: HABP1/C1QBP/GC1q R Antibody [NBP1-89790] - Immunofluorescent staining of human cell line A-431 shows localization to plasma membrane. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: HABP1/C1QBP/GC1q R Antibody [NBP1-89790] - Staining of human testis shows strong granular cytoplasmic positivity in cells in seminiferous ducts and Leydig cells.](http://images.novusbio.com/fullsize/HABP1-C1QBP-GC1q-R-Antibody-Immunohistochemistry-Paraffin-NBP1-89790-img0021.jpg "Immunohistochemistry-Paraffin: HABP1/C1QBP/GC1q R Antibody [NBP1-89790] - Staining of human testis shows strong granular cytoplasmic positivity in cells in seminiferous ducts and Leydig cells.")
![Western Blot: HABP1/C1QBP/GC1q R Antibody [NBP1-89790] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.](http://images.novusbio.com/fullsize/HABP1-C1QBP-GC1q-R-Antibody-Western-Blot-NBP1-89790-img0010.jpg "Western Blot: HABP1/C1QBP/GC1q R Antibody [NBP1-89790] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.")
![Immunohistochemistry-Paraffin: HABP1/C1QBP/GC1q R Antibody [NBP1-89790] - Staining of human colon shows strong granular cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/HABP1-C1QBP-GC1q-R-Antibody-Immunohistochemistry-Paraffin-NBP1-89790-img0018.jpg "Immunohistochemistry-Paraffin: HABP1/C1QBP/GC1q R Antibody [NBP1-89790] - Staining of human colon shows strong granular cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: HABP1/C1QBP/GC1q R Antibody [NBP1-89790] - Staining of human lymph node shows strong granular cytoplasmic positivity in non-germinal and germinal center cells.](http://images.novusbio.com/fullsize/HABP1-C1QBP-GC1q-R-Antibody-Immunohistochemistry-Paraffin-NBP1-89790-img0019.jpg "Immunohistochemistry-Paraffin: HABP1/C1QBP/GC1q R Antibody [NBP1-89790] - Staining of human lymph node shows strong granular cytoplasmic positivity in non-germinal and germinal center cells.")
![Immunohistochemistry-Paraffin: HABP1/C1QBP/GC1q R Antibody [NBP1-89790] - Staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules.](http://images.novusbio.com/fullsize/HABP1-C1QBP-GC1q-R-Antibody-Immunohistochemistry-Paraffin-NBP1-89790-img0020.jpg "Immunohistochemistry-Paraffin: HABP1/C1QBP/GC1q R Antibody [NBP1-89790] - Staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules.")
![C1qR1/CD93 Antibody [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "C1qR1/CD93 Antibody [Unconjugated]")
![Western Blot ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Western_Blot_5097.jpg)
![Immunohistochemistry ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Immunohistochemistry_20696.jpg)
![Knockout Validated ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Knockout_Validated_22864.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")