![Western Blot: Fascin Antibody [NBP3-03708] - Analysis of extracts of various cell lines, using Fascin antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit.](http://images.novusbio.com/fullsize/Fascin-Antibody-Western-Blot-NBP3-03708-img0004.jpg "Western Blot: Fascin Antibody [NBP3-03708] - Analysis of extracts of various cell lines, using Fascin antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC, KO |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 394-493 of human Fascin (NP_003079.1). FIGCRKVTGTLDANRSSYDVFQLEFNDGAYNIKDSTGKYWTVGSDSAVTSSGDTPVDFFFEFCDYNKVAIKVGGRYLKGDHAGVLKASAETVDPASLWEY |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | FSCN1 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Theoretical MW | 54 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.3), 50% glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for Fascin Antibody (NBP3-03708)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | FSCN1 |
![Immunocytochemistry/Immunofluorescence: Fascin Antibody [NBP3-03708] - Immunofluorescence analysis of NIH-3T3 cells using [KO Validated] Fascin/Fascin Rabbit pAb (NBP3-03708) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/Fascin-Antibody-Immunocytochemistry-Immunofluorescence-NBP3-03708-img0006.jpg "Immunocytochemistry/Immunofluorescence: Fascin Antibody [NBP3-03708] - Immunofluorescence analysis of NIH-3T3 cells using [KO Validated] Fascin/Fascin Rabbit pAb (NBP3-03708) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.")
![Immunohistochemistry-Paraffin: Fascin Antibody [NBP3-03708] - Immunohistochemistry of paraffin-embedded mouse testis using [KO Validated] Fascin/Fascin Rabbit pAb (NBP3-03708) at dilution of 1:100 (40x lens). Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.](http://images.novusbio.com/fullsize/Fascin-Antibody-Immunohistochemistry-Paraffin-NBP3-03708-img0007.jpg "Immunohistochemistry-Paraffin: Fascin Antibody [NBP3-03708] - Immunohistochemistry of paraffin-embedded mouse testis using [KO Validated] Fascin/Fascin Rabbit pAb (NBP3-03708) at dilution of 1:100 (40x lens). Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.")
![Immunocytochemistry/Immunofluorescence: Fascin Antibody [NBP3-03708] - Immunofluorescence analysis of C6 cells using [KO Validated] Fascin/Fascin Rabbit pAb (NBP3-03708) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/Fascin-Antibody-Immunocytochemistry-Immunofluorescence-NBP3-03708-img0005.jpg "Immunocytochemistry/Immunofluorescence: Fascin Antibody [NBP3-03708] - Immunofluorescence analysis of C6 cells using [KO Validated] Fascin/Fascin Rabbit pAb (NBP3-03708) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.")
![Knockout Validated: Fascin Antibody [NBP3-03708] - Analysis of extracts from normal (control) and FSCN1 knockout (KO) HeLa cells, using Fascin antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST.](http://images.novusbio.com/fullsize/Fascin-Antibody-Knockout-Validated-NBP3-03708-img0003.jpg "Knockout Validated: Fascin Antibody [NBP3-03708] - Analysis of extracts from normal (control) and FSCN1 knockout (KO) HeLa cells, using Fascin antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST.")
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![Bioactivity IL-2 [Unconjugated]](https://images.novusbio.com/images/202-il_recombinant-human-il-2-protein-bioactivity-174202314946.jpg)
![N/A TNF RII/TNFRSF1B [HRP]](https://images.novusbio.com/images2/TNF_RII_DRT200_ELISA_176.jpg)
![N/A TNF RII/TNFRSF1B [HRP]](https://images.novusbio.com/images2/DATA_TNF_RII_DRT200_ELISA_817.jpg)
![N/A TNF RII/TNFRSF1B [HRP]](https://images.novusbio.com/images2/DATA_TNF_RII_DRT200_ELISA_818.jpg)
![Western Blot LEDGF Antibody (762815) [Unconjugated]](https://images.novusbio.com/images2/12543.jpg)
![Immunocytochemistry LEDGF Antibody (762815) [Unconjugated]](https://images.novusbio.com/images2/12613.jpg)
![Neutralization Siglec-7/CD328 Antibody [Unconjugated]](https://images.novusbio.com/images2/Siglec-7_AF1138_Block_Neutralize_8760.jpg)
![Bioactivity CTLA-4 [Unconjugated]](https://images.novusbio.com/images2/CTLA4_7268CT_2293.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images2/DATA_IL6_M6000_ELISA_936.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images2/IL-6_M6000_ELISA_415.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images/m6000b_mouse-il-6-quantikine-elisa-kit-44202415433118.jpg)
![N/A TNF RI/TNFRSF1A [HRP]](https://images.novusbio.com/images2/DATA_TNF_RI_DRT100_ELISA_815.jpg)
![N/A TNF RI/TNFRSF1A [HRP]](https://images.novusbio.com/images2/DATA_TNF_RI_DRT100_ELISA_816.jpg)
![N/A TNF RI/TNFRSF1A [HRP]](https://images.novusbio.com/images2/TNF_RI_DRT100_ELISA_175.jpg)
![Bioactivity IL-4 [Unconjugated]](https://images.novusbio.com/images/protein/6507-ilcf_recombinant-human-il-4-cho-expressed-protein-cf-bioactivity-272020133214.jpg)
![N/A IL-10 [Biotin]](https://images.novusbio.com/images2/DATA_IL10_DY417_ELISA_2014.jpg)
![SDS-PAGE IL-1 beta/IL-1F2 [Unconjugated]](https://images.novusbio.com/images2/IL-1_beta_201-LB_304.jpg)
![Bioactivity IL-1 beta/IL-1F2 [Unconjugated]](https://images.novusbio.com/images2/IL-1_beta_201-LB_306.jpg)
![SEC-MALS IL-1 beta/IL-1F2 [Unconjugated]](https://images.novusbio.com/images/201-lb_recombinant-human-il-1-beta-il-1f2-protein-sec-mals-123202491556.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")