![Immunocytochemistry/Immunofluorescence: FAK Antibody [NBP1-84750] - Membrane surface receptor expression and metabolomic analysis of cells grown on porcine breast fatty tissue ECM hydrogel. Integrin beta1 (a) or beta4 (b) receptor (green) and FAK (red) expression in MM231 cells cultured on the ECM hydrogel-coated coverslips were assessed by IF. Phalloidin staining (white) of F-actin was used to contour the cells. Scale bars, 10 um. Image collected and cropped by CiteAb from the following publication (//www.mdpi.com/1422-0067/19/10/2912), licensed under a CC-BY license.](http://images.novusbio.com/fullsize/FAK-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-84750-img0012.jpg "Immunocytochemistry/Immunofluorescence: FAK Antibody [NBP1-84750] - Membrane surface receptor expression and metabolomic analysis of cells grown on porcine breast fatty tissue ECM hydrogel. Integrin beta1 (a) or beta4 (b) receptor (green) and FAK (red) expression in MM231 cells cultured on the ECM hydrogel-coated coverslips were assessed by IF. Phalloidin staining (white) of F-actin was used to contour the cells. Scale bars, 10 um. Image collected and cropped by CiteAb from the following publication (//www.mdpi.com/1422-0067/19/10/2912), licensed under a CC-BY license.")
| Reactivity | Hu, Po, Mu, RtSpecies Glossary |
| Applications | ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: PEEGISYLTDKGCNPTHLADFTQVQTIQYSNSEDKDRKGMLQLKIAGAPEPLTVTAPSLTIAENMADLIDGYCRLVNGTSQSFIIRPQKEGERALPSIPKLANSEKQGMRTHAVSVSETDDYAEIIDEEDTYTMPSTRDYEIQRE |
| Marker | Focal Adhesion Marker |
| Predicted Species | Mouse (98%), Rat (97%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | PTK2 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Western Blot AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Western_Blot_5930.jpg)
![Simple Western AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/16332.jpg)
![Intracellular Staining by Flow Cytometry AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Flow_Cytometry_8283.jpg)
![Simple Western EphB2 Antibody [Unconjugated]](https://images.novusbio.com/images2/EphB2_AF467_Simple_Western_21454.jpg)
![Western Blot EphB2 Antibody [Unconjugated]](https://images.novusbio.com/images2/EphB2_AF467_Western_Blot_21511.jpg)
![Immunocytochemistry EphB2 Antibody [Unconjugated]](https://images.novusbio.com/images2/EphB2_AF467_Immunocytochemistry__Immunofluorescence_17288.jpg)
![Immunohistochemistry EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Immunohistochemistry_20892.jpg)
![Immunocytochemistry EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Immunocytochemistry__Immunofluorescence_21143.jpg)
![Western Blot EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Western_Blot_19925.jpg)
| Publication using NBP1-84750 | Applications | Species |
|---|---|---|
| Rijal G, Wang J, Yu I et al. Porcine Breast Extracellular Matrix Hydrogel for Spatial Tissue Culture. Int J Mol Sci. 2018-09-25 [PMID: 30257480] (ICC/IF, Porcine) | ICC/IF | Porcine |
Secondary Antibodies |
Isotype Controls |
Research Areas for FAK Antibody (NBP1-84750)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | PTK2 |
![Immunohistochemistry-Paraffin: FAK Antibody [NBP1-84750] - Staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.](http://images.novusbio.com/fullsize/FAK-Antibody-Immunohistochemistry-Paraffin-NBP1-84750-img0011.jpg "Immunohistochemistry-Paraffin: FAK Antibody [NBP1-84750] - Staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.")
![Immunocytochemistry/Immunofluorescence: FAK Antibody [NBP1-84750] - Staining of human cell line U-2 OS shows localization to cytosol & focal adhesion sites. Antibody staining shown in green.](http://images.novusbio.com/fullsize/FAK-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-84750-img0005.jpg "Immunocytochemistry/Immunofluorescence: FAK Antibody [NBP1-84750] - Staining of human cell line U-2 OS shows localization to cytosol & focal adhesion sites. Antibody staining shown in green.")
![Immunohistochemistry-Paraffin: FAK Antibody [NBP1-84750] - Staining of human fallopian tube shows moderate cytoplasmic and membranous positivity in glandular cells.](http://images.novusbio.com/fullsize/FAK-Antibody-Immunohistochemistry-Paraffin-NBP1-84750-img0007.jpg "Immunohistochemistry-Paraffin: FAK Antibody [NBP1-84750] - Staining of human fallopian tube shows moderate cytoplasmic and membranous positivity in glandular cells.")
![Immunohistochemistry-Paraffin: FAK Antibody [NBP1-84750] - Staining of human testis shows moderate to cytoplasmic positivity in spermatogonia and Leydig cells.](http://images.novusbio.com/fullsize/FAK-Antibody-Immunohistochemistry-Paraffin-NBP1-84750-img0009.jpg "Immunohistochemistry-Paraffin: FAK Antibody [NBP1-84750] - Staining of human testis shows moderate to cytoplasmic positivity in spermatogonia and Leydig cells.")
![Immunohistochemistry-Paraffin: FAK Antibody [NBP1-84750] - Staining of human cerebellum shows moderate cytoplasmic positivity in Purkinje cells.](http://images.novusbio.com/fullsize/FAK-Antibody-Immunohistochemistry-Paraffin-NBP1-84750-img0010.jpg "Immunohistochemistry-Paraffin: FAK Antibody [NBP1-84750] - Staining of human cerebellum shows moderate cytoplasmic positivity in Purkinje cells.")
![Immunocytochemistry/ Immunofluorescence: FAK Antibody [NBP1-84750] - Membrane surface receptor expression & metabolomic analysis of cells grown on porcine breast fatty tissue ECM hydrogel. Integrin beta 1 (a) or beta 4 (b) receptor (green) & FAK (red) expression in MM231 cells cultured on the ECM hydrogel-coated coverslips were assessed by IF. Phalloidin staining (white) of F-actin was used to contour the cells. Scale bars, 10 μm. (c) MS imaging of cross sections of the medium-conditioned blank (upper panels) & MM231 cell culture-laden (bottom panels) hydrogel scaffolds. (d) Examples of ROC (upper) & box-and-whiskers (bottom) plots from the MS imaging analysis, showing data for a compound with m/z 663.024, where differences between the hydrogel samples cultured with or without MM231 cells are clearly evident. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/30257480), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/nbp1-84750_rabbit-polyclonal-fak-antibody-310202415284542.jpg "Immunocytochemistry/ Immunofluorescence: FAK Antibody [NBP1-84750] - Membrane surface receptor expression & metabolomic analysis of cells grown on porcine breast fatty tissue ECM hydrogel. Integrin beta 1 (a) or beta 4 (b) receptor (green) & FAK (red) expression in MM231 cells cultured on the ECM hydrogel-coated coverslips were assessed by IF. Phalloidin staining (white) of F-actin was used to contour the cells. Scale bars, 10 μm. (c) MS imaging of cross sections of the medium-conditioned blank (upper panels) & MM231 cell culture-laden (bottom panels) hydrogel scaffolds. (d) Examples of ROC (upper) & box-and-whiskers (bottom) plots from the MS imaging analysis, showing data for a compound with m/z 663.024, where differences between the hydrogel samples cultured with or without MM231 cells are clearly evident. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/30257480), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![Immunocytochemistry Paxillin Antibody [Unconjugated]](https://images.novusbio.com/images2/Paxillin_AF4259_Immunocytochemistry_10249.jpg)
![Western Blot Paxillin Antibody [Unconjugated]](https://images.novusbio.com/images2/Paxillin_AF4259_Western_Blot_5429.jpg)
![Simple Western Paxillin Antibody [Unconjugated]](https://images.novusbio.com/images2/Paxillin_AF4259_Simple_Western_17510.jpg)
![Western Blot Src [p Tyr419] Antibody [Unconjugated]](https://images.novusbio.com/images2/Src_AF2685_Western_Blot_5209.jpg)
![Simple Western Src [p Tyr419] Antibody [Unconjugated]](https://images.novusbio.com/images2/16327.jpg)
![Immunohistochemistry Src [p Tyr419] Antibody [Unconjugated]](https://images.novusbio.com/images2/Src_AF2685_Immunohistochemistry_7158.jpg)
![Western Blot ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Western_Blot_5097.jpg)
![Immunohistochemistry ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Immunohistochemistry_20696.jpg)
![Knockout Validated ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Knockout_Validated_22864.jpg)
![Flow Cytometry Integrin beta 1/CD29 Antibody (P5D2) [Unconjugated]](https://images.novusbio.com/images2/Integrin_beta_1_MAB17781_Flow_Cytometry_17077.jpg)
![Immunocytochemistry Integrin beta 1/CD29 Antibody (P5D2) [Unconjugated]](https://images.novusbio.com/images2/Integrin_beta_1_MAB17781_Immunocytochemistry__Immunofluorescence_17398.jpg)
![Flow Cytometry Integrin beta 1/CD29 Antibody (P5D2) [Unconjugated]](https://images.novusbio.com/images2/Integrin_beta_1_MAB17781_Flow_Cytometry_23861.jpg)
![Simple Western Vinculin Antibody (728526) [Unconjugated]](https://images.novusbio.com/images2/Vinculin_MAB6896_Simple_Western_16408.jpg)
![Western Blot Vinculin Antibody (728526) [Unconjugated]](https://images.novusbio.com/images2/Vinculin_MAB6896_Western_Blot_11566.jpg)
![Immunohistochemistry Vinculin Antibody (728526) [Unconjugated]](https://images.novusbio.com/images2/Vinculin_MAB6896_Immunohistochemistry_11621.jpg)
![N/A VEGF [HRP]](https://images.novusbio.com/images2/DATA_VEGF_DVE00_ELISA_871.jpg)
![N/A VEGF [HRP]](https://images.novusbio.com/images2/DATA_VEGF_DVE00_ELISA_872.jpg)
![N/A VEGF [HRP]](https://images.novusbio.com/images2/VEGF_DVE00_ELISA_208.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")