![Western Blot: DIAPH-2 Antibody (CL1111) [NBP2-52966] - Lane 1: Marker [kDa], Lane 2: Human cell line U-251 MG](http://images.novusbio.com/fullsize/DIAPH-2-Antibody-CL1111-Western-Blot-NBP2-52966-img0007.jpg "Western Blot: DIAPH-2 Antibody (CL1111) [NBP2-52966] - Lane 1: Marker [kDa], Lane 2: Human cell line U-251 MG")
| Reactivity | HuSpecies Glossary |
| Applications | WB, IHC, KD |
| Clone | CL1111 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: GGSEEPGGGRSNKRSAGNRAANEEETKNKPKLNIQIKTLADDVRDRITSFRKSTVKKEKPLIQHPIDSQVAMSEFPAAQPLYDERSLNLSEKEVLDLFEKMMEDMNLNEEKKAPLRNKDFTTKREMVVQYISAT |
| Epitope | SLNLSEKEVLDLFEK |
| Isotype | IgG1 |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | DIAPH2 |
| Purity | Protein A purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Protein A purified |
![Simple Western Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Simple_Western_21888.jpg)
![Immunocytochemistry Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Immunocytochemistry__Immunofluorescence_17777.jpg)
![Immunohistochemistry Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Immunohistochemistry_23317.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for DIAPH-2 Antibody (NBP2-52966)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | DIAPH2 |
![Immunohistochemistry-Paraffin: DIAPH-2 Antibody (CL1111) [NBP2-52966] - Staining of human uterus shows strong cytoplasmic immunoreactivity in glandular cells.](http://images.novusbio.com/fullsize/DIAPH-2-Antibody-CL1111-Immunohistochemistry-Paraffin-NBP2-52966-img0006.jpg "Immunohistochemistry-Paraffin: DIAPH-2 Antibody (CL1111) [NBP2-52966] - Staining of human uterus shows strong cytoplasmic immunoreactivity in glandular cells.")
![Immunohistochemistry-Paraffin: DIAPH-2 Antibody (CL1111) [NBP2-52966] - Staining of human colorectal cancer shows strong cytoplasmic immunoreactivity in tumor cells.](http://images.novusbio.com/fullsize/DIAPH-2-Antibody-CL1111-Immunohistochemistry-Paraffin-NBP2-52966-img0001.jpg "Immunohistochemistry-Paraffin: DIAPH-2 Antibody (CL1111) [NBP2-52966] - Staining of human colorectal cancer shows strong cytoplasmic immunoreactivity in tumor cells.")
![Immunohistochemistry-Paraffin: DIAPH-2 Antibody (CL1111) [NBP2-52966] - Staining of human fallopian tube shows strong cytoplasmic positivity in epithelial cells.](http://images.novusbio.com/fullsize/DIAPH-2-Antibody-CL1111-Immunohistochemistry-Paraffin-NBP2-52966-img0002.jpg "Immunohistochemistry-Paraffin: DIAPH-2 Antibody (CL1111) [NBP2-52966] - Staining of human fallopian tube shows strong cytoplasmic positivity in epithelial cells.")
![Immunohistochemistry-Paraffin: DIAPH-2 Antibody (CL1111) [NBP2-52966] - Staining of human placenta shows strong staining in the trophoblast.](http://images.novusbio.com/fullsize/DIAPH-2-Antibody-CL1111-Immunohistochemistry-Paraffin-NBP2-52966-img0003.jpg "Immunohistochemistry-Paraffin: DIAPH-2 Antibody (CL1111) [NBP2-52966] - Staining of human placenta shows strong staining in the trophoblast.")
![Immunohistochemistry-Paraffin: DIAPH-2 Antibody (CL1111) [NBP2-52966] - Staining of human skeletal muscle shows absence of immunoreactivity (negative control).](http://images.novusbio.com/fullsize/DIAPH-2-Antibody-CL1111-Immunohistochemistry-Paraffin-NBP2-52966-img0004.jpg "Immunohistochemistry-Paraffin: DIAPH-2 Antibody (CL1111) [NBP2-52966] - Staining of human skeletal muscle shows absence of immunoreactivity (negative control).")
![Immunohistochemistry-Paraffin: DIAPH-2 Antibody (CL1111) [NBP2-52966] - Staining of human testis shows strong cytoplasmic immunoreactivity in seminiferous tubules cells.](http://images.novusbio.com/fullsize/DIAPH-2-Antibody-CL1111-Immunohistochemistry-Paraffin-NBP2-52966-img0005.jpg "Immunohistochemistry-Paraffin: DIAPH-2 Antibody (CL1111) [NBP2-52966] - Staining of human testis shows strong cytoplasmic immunoreactivity in seminiferous tubules cells.")
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![SDS-PAGE IGF-I/IGF-1 [Unconjugated]](https://images.novusbio.com/images2/IGF-I_291-G1_40.jpg)
![Bioactivity IGF-I/IGF-1 [Unconjugated]](https://images.novusbio.com/images2/IGF-I_291-G1_41.jpg)
![Mass Spectrometry IGF-I/IGF-1 [Unconjugated]](https://images.novusbio.com/images2/IGF-I_291-G1_42.jpg)
![Western Blot Androgen R/NR3C4 [p Ser213, p Ser210] Antibody (156C135.2) - BSA Free](https://images.novusbio.com/images/Androgen-R-NR3C4-p-Ser213-p-Ser210-Antibody-156C135-2-Western-Blot-NB100-56603-img0004.jpg)
![SDS-Page: Mouse IgG1 Isotype Control (MG1) [NBP1-97005] - Lane 1: , Non-reduced. M: Opal Pre-stained Ladder. Lane 2: , Reduced. Load: 1.0 ug per lane. Predicted/Observed: 120 kDa Non-reduced, 55 and 25 Reduced.](https://images.novusbio.com/images/Mouse-IgG1-Isotype-Control-MG1-SDS-Page-NBP1-97005-img0002.jpg "SDS-Page: Mouse IgG1 Isotype Control (MG1) [NBP1-97005] - Lane 1: , Non-reduced. M: Opal Pre-stained Ladder. Lane 2: , Reduced. Load: 1.0 ug per lane. Predicted/Observed: 120 kDa Non-reduced, 55 and 25 Reduced.")