![Immunohistochemistry-Paraffin: CD21 Antibody [NBP2-38895] - Analysis in human lymph node and endometrium tissues. Corresponding CR2 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/CD21-Antibody-Immunohistochemistry-Paraffin-NBP2-38895-img0003.jpg "Immunohistochemistry-Paraffin: CD21 Antibody [NBP2-38895] - Analysis in human lymph node and endometrium tissues. Corresponding CR2 RNA-seq data are presented for the same tissues.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: VIRYSCSGTFRLIGEKSLLCITKDKVDGTWDKPAPKCEYFNKYSSCPEPIVPGGYKIRGSTPYRHGDSVTFACKTNFSMNGNKS |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | CR2 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Simple Western Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Simple_Western_21888.jpg)
![Immunocytochemistry Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Immunocytochemistry__Immunofluorescence_17777.jpg)
![Immunohistochemistry Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Immunohistochemistry_23317.jpg)
| Publication using NBP2-38895 | Applications | Species |
|---|---|---|
| Costa V, El-Achkar VN, de Barros PP, et al. Role of epstein-barr virus in the severity of recurrent respiratory papillomatosis Laryngoscope 2019-12-20 [PMID: 31860132] (IF/IHC, Human) | IF/IHC | Human |
Secondary Antibodies |
Isotype Controls |
Research Areas for CD21 Antibody (NBP2-38895)Find related products by research area.
|
|
How To Identify B Cell Subsets Using Flow Cytometry By Victoria OsinskiUsing Flow Cytometry to Identify B Cell SubsetsIdentifying cellular subsets by flow cytometry requires careful and thorough planning in order to ensure the correct subset of cells are identified... Read full blog post. |
|
CD19: An Undoubted Biomarker for B Cells CD19 is a cell surface protein member of the large immunoglobulin superfamily that complexes with CD21, CD81, and CD225 in the membrane of mature B-cells. A major function of CD19 is to assemble with the antigen receptor of B-lymphocytes to decrease t... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry-Paraffin: CD21 Antibody [NBP2-38895] -Staining of human lymph node shows strong membranous positivity in germinal center cells.](http://images.novusbio.com/fullsize/CD21-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-38895-img0011.jpg "Immunohistochemistry-Paraffin: CD21 Antibody [NBP2-38895] -Staining of human lymph node shows strong membranous positivity in germinal center cells.")
![Immunohistochemistry-Paraffin: CD21 Antibody [NBP2-38895] - Staining of human endometrium, kidney, lymph node and tonsil using Anti-CD21 antibody NBP2-38895 (A) shows similar protein distribution across tissues to independent antibody NBP2-38684 (B).](http://images.novusbio.com/fullsize/CD21-Antibody-Immunohistochemistry-Paraffin-NBP2-38895-img0010.jpg "Immunohistochemistry-Paraffin: CD21 Antibody [NBP2-38895] - Staining of human endometrium, kidney, lymph node and tonsil using Anti-CD21 antibody NBP2-38895 (A) shows similar protein distribution across tissues to independent antibody NBP2-38684 (B).")
![Western Blot: CD21 Antibody [NBP2-38895] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG. Lane 4: Human Plasma. Lane 5: Human liver tissue. Lane 6: Human tonsil tissue](http://images.novusbio.com/fullsize/CD21-Antibody-Western-Blot-NBP2-38895-img0002.jpg "Western Blot: CD21 Antibody [NBP2-38895] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG. Lane 4: Human Plasma. Lane 5: Human liver tissue. Lane 6: Human tonsil tissue")
![Immunohistochemistry-Paraffin: CD21 Antibody [NBP2-38895] - Staining of human endometrium shows no positivity in glandular cells as expected.](http://images.novusbio.com/fullsize/CD21-Antibody-Immunohistochemistry-Paraffin-NBP2-38895-img0006.jpg "Immunohistochemistry-Paraffin: CD21 Antibody [NBP2-38895] - Staining of human endometrium shows no positivity in glandular cells as expected.")
![Immunohistochemistry-Paraffin: CD21 Antibody [NBP2-38895] - Staining of human lymph node shows strong membranous positivity in germinal center cells.](http://images.novusbio.com/fullsize/CD21-Antibody-Immunohistochemistry-Paraffin-NBP2-38895-img0007.jpg "Immunohistochemistry-Paraffin: CD21 Antibody [NBP2-38895] - Staining of human lymph node shows strong membranous positivity in germinal center cells.")
![Immunohistochemistry-Paraffin: CD21 Antibody [NBP2-38895] - Staining of human tonsil shows strong membranous positivity in germinal center cells.](http://images.novusbio.com/fullsize/CD21-Antibody-Immunohistochemistry-Paraffin-NBP2-38895-img0008.jpg "Immunohistochemistry-Paraffin: CD21 Antibody [NBP2-38895] - Staining of human tonsil shows strong membranous positivity in germinal center cells.")
![Immunohistochemistry-Paraffin: CD21 Antibody [NBP2-38895] - Staining of human kidney shows very weak membranous positivity in cells in tubules as expected.](http://images.novusbio.com/fullsize/CD21-Antibody-Immunohistochemistry-Paraffin-NBP2-38895-img0009.jpg "Immunohistochemistry-Paraffin: CD21 Antibody [NBP2-38895] - Staining of human kidney shows very weak membranous positivity in cells in tubules as expected.")
![Bioactivity CTLA-4 [Unconjugated]](https://images.novusbio.com/images2/CTLA4_7268CT_2293.jpg)
![Western Blot RB1 Antibody (607121) [Unconjugated]](https://images.novusbio.com/images2/RB1_MAB6495_Western_Blot_10216.jpg)
![Immunocytochemistry RB1 Antibody (607121) [Unconjugated]](https://images.novusbio.com/images2/RB1_MAB6495_Immunocytochemistry_10464.jpg)
![Simple Western RB1 Antibody (607121) [Unconjugated]](https://images.novusbio.com/images2/RB1_MAB6495_Simple_Western_16629.jpg)
![Immunocytochemistry CD23/Fc epsilon RII Antibody [Unconjugated]](https://images.novusbio.com/images2/CD23_AF123_Immunocytochemistry_6469.jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![Western Blot Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Western_Blot_5287.jpg)
![Simple Western Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Simple_Western_16990.jpg)
![Knockout Validated Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Knockout_Validated_24032.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")