CCR8 Antibody (9N1Y1) Summary
Additional Information |
Recombinant Monoclonal Antibody |
Immunogen |
A synthetic peptide corresponding to a sequence within amino acids 250-355 of human CCR8 (P51685). FWVPFNVVLFLTSLHSMHILDGCSISQQLTYATHVTEIISFTHCCVNPVIYAFVGEKFKKHLSEIFQKSCSQIFNYLGRQMPRESCEKSSSCQQHSSRSSSVDYIL |
Isotype |
IgG |
Clonality |
Monoclonal |
Host |
Rabbit |
Gene |
CCR8 |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- ELISA
- Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
- Western Blot 1:500 - 1:2000
|
Theoretical MW |
41 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
Storage |
Store at -20C. Avoid freeze-thaw cycles. |
Buffer |
PBS, 0.05% BSA, 50% glycerol, pH7.3 |
Preservative |
0.02% Sodium Azide |
Purity |
Affinity purified |
Alternate Names for CCR8 Antibody (9N1Y1)
Background
CKR8/CCR8, or C-C chemokine receptor type 8, is a G protein-coupled, seven-transmembrane domain receptor protein. Chemokines are key molecules in directing leukocyte migration toward sites of inflammation. The human C-C chemokine I-309 is a monocyte chemoattractant and inhibits apoptosis in thymic cell lines. It has been found that CKR8/CCR8 is a receptor for chemokines SCYA1/I-309, SCYA4/MIP-1-beta, and SCYA17/TARC (1-3).
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ELISA
Species: Hu
Applications: CyTOF-ready, Flow, ICC, Neut
Species: Hu
Applications: CyTOF-reported, Flow
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: CyTOF-ready, Flow, IHC, Neut
Species: Mu
Applications: ELISA
Species: Hu
Applications: CyTOF-ready, Flow, IHC, Neut
Species: Hu
Applications: ELISA
Species: Hu
Applications: CyTOF-ready, Flow
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu
Applications: CyTOF-ready, Flow, IHC, Neut
Species: Hu
Applications: CyTOF-ready, Flow, IHC
Species: Hu
Applications: ELISA
Species: Hu
Applications: ELISA
Species: Hu
Applications: BA
Species: Mu
Applications: CyTOF-ready, Flow, ICC
Species: Hu
Applications: CyTOF-reported, Dual ISH-IHC, Flow, ICC, IHC, Neut
Species: Hu
Applications: CyTOF-ready, Flow, IHC
Species: Hu
Applications: BA
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
Publications for CCR8 Antibody (NBP3-16370) (0)
There are no publications for CCR8 Antibody (NBP3-16370).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for CCR8 Antibody (NBP3-16370) (0)
There are no reviews for CCR8 Antibody (NBP3-16370).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for CCR8 Antibody (NBP3-16370) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional CCR8 Products
Research Areas for CCR8 Antibody (NBP3-16370)
Find related products by research area.
|
Blogs on CCR8