![Western Blot: ARHGEF6 Antibody [NBP1-89124] - Analysis in human cell line HL-60.](http://images.novusbio.com/fullsize/ARHGEF6-Antibody-Western-Blot-NBP1-89124-img0006.jpg "Western Blot: ARHGEF6 Antibody [NBP1-89124] - Analysis in human cell line HL-60.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: VQYGACEEKEERYLMLFSNVLIMLSASPRMSGFIYQGKIPIAGTVVTRLDEIEGNDCTFEITGNTVERIVVHCNNNQDFQEWLEQLNRLIRGPASCSSLSKTSSSSCSAHS |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | ARHGEF6 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Theoretical MW | 87 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Western Blot PAK3 Antibody [Unconjugated]](https://images.novusbio.com/images2/PAK3_AF6897_Western_Blot_11082.jpg)
![Immunohistochemistry PAK3 Antibody [Unconjugated]](https://images.novusbio.com/images2/PAK3_AF6897_Immunohistochemistry_11144.jpg)
![Immunohistochemistry PAK3 Antibody [Unconjugated]](https://images.novusbio.com/images2/PAK3_AF6897_Immunohistochemistry_11480.jpg)
![Western Blot AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Western_Blot_5930.jpg)
![Simple Western AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/16332.jpg)
![Intracellular Staining by Flow Cytometry AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Flow_Cytometry_8283.jpg)
| Publication using NBP1-89124 | Applications | Species |
|---|---|---|
| Kortum F, Harms FL, Hennighausen N et al. alphaPIX Is a Trafficking Regulator that Balances Recycling and Degradation of the Epidermal Growth Factor Receptor. PLoS One 2015-01-01 [PMID: 26177020] |
Secondary Antibodies |
Isotype Controls |
Research Areas for ARHGEF6 Antibody (NBP1-89124)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunocytochemistry/Immunofluorescence: ARHGEF6 Antibody [NBP1-89124] - Immunofluorescent staining of human cell line U-251 MG shows localization to cytosol.](http://images.novusbio.com/fullsize/ARHGEF6-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-89124-img0008.jpg "Immunocytochemistry/Immunofluorescence: ARHGEF6 Antibody [NBP1-89124] - Immunofluorescent staining of human cell line U-251 MG shows localization to cytosol.")
![Immunohistochemistry-Paraffin: ARHGEF6 Antibody [NBP1-89124] - Staining of human tonsil shows moderate cytoplasmic positivity in non-germinal center cells.](http://images.novusbio.com/fullsize/ARHGEF6-Antibody-Immunohistochemistry-Paraffin-NBP1-89124-img0012.jpg "Immunohistochemistry-Paraffin: ARHGEF6 Antibody [NBP1-89124] - Staining of human tonsil shows moderate cytoplasmic positivity in non-germinal center cells.")
![Immunohistochemistry-Paraffin: ARHGEF6 Antibody [NBP1-89124] - Staining of human cerebral cortex shows very weak cytoplasmic positivity in neurons.](http://images.novusbio.com/fullsize/ARHGEF6-Antibody-Immunohistochemistry-Paraffin-NBP1-89124-img0009.jpg "Immunohistochemistry-Paraffin: ARHGEF6 Antibody [NBP1-89124] - Staining of human cerebral cortex shows very weak cytoplasmic positivity in neurons.")
![Immunohistochemistry-Paraffin: ARHGEF6 Antibody [NBP1-89124] - Staining of human liver shows no positivity in hepatocytes as expected.](http://images.novusbio.com/fullsize/ARHGEF6-Antibody-Immunohistochemistry-Paraffin-NBP1-89124-img0010.jpg "Immunohistochemistry-Paraffin: ARHGEF6 Antibody [NBP1-89124] - Staining of human liver shows no positivity in hepatocytes as expected.")
![Immunohistochemistry-Paraffin: ARHGEF6 Antibody [NBP1-89124] - Staining of human small intestine shows weak cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/ARHGEF6-Antibody-Immunohistochemistry-Paraffin-NBP1-89124-img0011.jpg "Immunohistochemistry-Paraffin: ARHGEF6 Antibody [NBP1-89124] - Staining of human small intestine shows weak cytoplasmic positivity in glandular cells.")
![Western Blot SOS2 Antibody [Unconjugated]](https://images.novusbio.com/images2/SOS2_AF6260_Western_Blot_9542.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")