![Immunohistochemistry-Paraffin: TSPAN7/TM4SF2 Antibody (CL0262) [NBP2-52894] - Analysis in human cerebral cortex and testis tissues using NBP2-52894 antibody. Corresponding TSPAN7 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/antibody/nbp2-52894_mouse-monoclonal-tspan7-tm4sf2-antibody-cl0262-immunohistochemistry-paraffin-116202412302..jpg "Immunohistochemistry-Paraffin: TSPAN7/TM4SF2 Antibody (CL0262) [NBP2-52894] - Analysis in human cerebral cortex and testis tissues using NBP2-52894 antibody. Corresponding TSPAN7 RNA-seq data are presented for the same tissues.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, IHC |
| Clone | CL0262 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: TFLRTYTDAMQTYNGNDERSRAVDHVQRSLSCCGVQNYTNWSTSPYFLEHGIPPSCCMNETDCNPQDLHNLTVAATKVNQKGCYDLVTSFMET |
| Epitope | NDERSRAVDHVQRSL |
| Predicted Species | Mouse (96%), Rat (96%). Backed by our 100% Guarantee. |
| Isotype | IgG1 |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | TSPAN7 |
| Purity | Protein A purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Protein A purified |
![Western Blot AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Western_Blot_5930.jpg)
![Simple Western AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/16332.jpg)
![Intracellular Staining by Flow Cytometry AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Flow_Cytometry_8283.jpg)
![Flow Cytometry IGSF8/CD316 Antibody [Unconjugated]](https://images.novusbio.com/images2/IGSF8_AF3117_Flow_Cytometry_16149.jpg)
![Western Blot IGSF8/CD316 Antibody [Unconjugated]](https://images.novusbio.com/images2/IGSF8_AF3117_Western_Blot_22478.jpg)
![Western Blot IGSF8/CD316 Antibody [Unconjugated]](https://images.novusbio.com/images2/IGSF8_AF3117_Western_Blot_23753.jpg)
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | TSPAN7 |
![Western Blot: TSPAN7/TM4SF2 Antibody (CL0262) [NBP2-52894] - Lane 1: Marker [kDa], Lane 2: Negative control (vector only transfected HEK293T lysate), Lane 3: TSPAN7 Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells)](http://images.novusbio.com/fullsize/TSPAN7-TM4SF2-Antibody-CL0262-Western-Blot-NBP2-52894-img0004.jpg "Western Blot: TSPAN7/TM4SF2 Antibody (CL0262) [NBP2-52894] - Lane 1: Marker [kDa], Lane 2: Negative control (vector only transfected HEK293T lysate), Lane 3: TSPAN7 Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells)")
![Immunohistochemistry-Paraffin: TSPAN7/TM4SF2 Antibody (CL0262) [NBP2-52894] - Staining of human cerebral cortex shows moderate positivity in neuropil.](http://images.novusbio.com/fullsize/antibody/nbp2-52894_mouse-monoclonal-tspan7-tm4sf2-antibody-cl0262-immunohistochemistry-paraffin-116202412313..jpg "Immunohistochemistry-Paraffin: TSPAN7/TM4SF2 Antibody (CL0262) [NBP2-52894] - Staining of human cerebral cortex shows moderate positivity in neuropil.")
![Immunohistochemistry-Paraffin: TSPAN7/TM4SF2 Antibody (CL0262) [NBP2-52894] - Staining of human cerebellum shows moderate positivity in neuropil.](http://images.novusbio.com/fullsize/antibody/nbp2-52894_mouse-monoclonal-tspan7-tm4sf2-antibody-cl0262-immunohistochemistry-paraffin-116202412320..jpg "Immunohistochemistry-Paraffin: TSPAN7/TM4SF2 Antibody (CL0262) [NBP2-52894] - Staining of human cerebellum shows moderate positivity in neuropil.")
![Immunohistochemistry-Paraffin: TSPAN7/TM4SF2 Antibody (CL0262) [NBP2-52894] - Staining of human pancreas shows moderate to strong cytoplasmic positivity in islets of Langerhans.](http://images.novusbio.com/fullsize/antibody/nbp2-52894_mouse-monoclonal-tspan7-tm4sf2-antibody-cl0262-immunohistochemistry-paraffin-1162024123247..jpg "Immunohistochemistry-Paraffin: TSPAN7/TM4SF2 Antibody (CL0262) [NBP2-52894] - Staining of human pancreas shows moderate to strong cytoplasmic positivity in islets of Langerhans.")
![Immunohistochemistry-Paraffin: TSPAN7/TM4SF2 Antibody (CL0262) [NBP2-52894] -Staining of human testis shows no positivity in cells in seminiferous ducts as expected.](http://images.novusbio.com/fullsize/antibody/nbp2-52894_mouse-monoclonal-tspan7-tm4sf2-antibody-cl0262-immunohistochemistry-paraffin-1162024123333..jpg "Immunohistochemistry-Paraffin: TSPAN7/TM4SF2 Antibody (CL0262) [NBP2-52894] -Staining of human testis shows no positivity in cells in seminiferous ducts as expected.")
![Bioactivity CTLA-4 [Unconjugated]](https://images.novusbio.com/images2/CTLA4_7268CT_2293.jpg)
![Flow Cytometry CD151 Antibody (455807) [Unconjugated]](https://images.novusbio.com/images2/CD151_MAB4609_Flow_Cytometry_8473.jpg)
![Immunocytochemistry CD151 Antibody (455807) [Unconjugated]](https://images.novusbio.com/images2/CD151_MAB4609_Immunocytochemistry__Immunofluorescence_19523.jpg)
![Immunocytochemistry TM4SF1/L6 Antibody (877621) [Unconjugated]](https://images.novusbio.com/images2/TM4SF1_MAB8164_Immunohistochemistry_19084.jpg)
![Flow Cytometry TM4SF1/L6 Antibody (877621) [Unconjugated]](https://images.novusbio.com/images2/TM4SF1_MAB8164_Flow_Cytometry_14781.jpg)
![Flow Cytometry TM4SF1/L6 Antibody (877621) [Unconjugated]](https://images.novusbio.com/images2/TM4SF1_MAB8164_Flow_Cytometry_14884.jpg)
![SDS-Page: Mouse IgG1 Isotype Control (MG1) [NBP1-97005] - Lane 1: , Non-reduced. M: Opal Pre-stained Ladder. Lane 2: , Reduced. Load: 1.0 ug per lane. Predicted/Observed: 120 kDa Non-reduced, 55 and 25 Reduced.](https://images.novusbio.com/images/Mouse-IgG1-Isotype-Control-MG1-SDS-Page-NBP1-97005-img0002.jpg "SDS-Page: Mouse IgG1 Isotype Control (MG1) [NBP1-97005] - Lane 1: , Non-reduced. M: Opal Pre-stained Ladder. Lane 2: , Reduced. Load: 1.0 ug per lane. Predicted/Observed: 120 kDa Non-reduced, 55 and 25 Reduced.")