![Knockdown Validated: TSPAN1 Antibody [NBP2-33867] - Knockdown tetraspanin 1 (TSPAN1) promoted molecular characterization of epithelial-to-mesenchymal transition state in alveolar epithelial cells. Interference efficiency of siRNA for TSPAN1 was identified in 293T cells by Western blotting. Four siRNA sequences, named si-TSPAN1-1, si-TSPAN1-2, si-TSPAN1-3 and si-TSPAN1-4, were designed to aim four target sites for TSPAN1. Image collected and cropped by CiteAb from the following publication (//doi.wiley.com/10.1111/jcmm.14258), licensed under a CC-BY license.](http://images.novusbio.com/fullsize/TSPAN1-Antibody-Knockdown-Validated-NBP2-33867-img0018.jpg "Knockdown Validated: TSPAN1 Antibody [NBP2-33867] - Knockdown tetraspanin 1 (TSPAN1) promoted molecular characterization of epithelial-to-mesenchymal transition state in alveolar epithelial cells. Interference efficiency of siRNA for TSPAN1 was identified in 293T cells by Western blotting. Four siRNA sequences, named si-TSPAN1-1, si-TSPAN1-2, si-TSPAN1-3 and si-TSPAN1-4, were designed to aim four target sites for TSPAN1. Image collected and cropped by CiteAb from the following publication (//doi.wiley.com/10.1111/jcmm.14258), licensed under a CC-BY license.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ICC/IF, IHC, KD |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: TMAEHFLTLLVVPAIKKDYGSQEDFTQVWNTTMKGLKCCGFTNYTDFEDSPYFKENSAFPPFCCNDNVTNTANETCTKQKAHDQKVEGCFNQLLYDIRTNAVTV |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | TSPAN1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Western Blot: TSPAN1 Antibody [NBP2-33867] - Analysis in human cell line PC-3 and human cell line HeLa.](http://images.novusbio.com/fullsize/TSPAN1-Antibody-Western-Blot-NBP2-33867-img0017.jpg "Western Blot: TSPAN1 Antibody [NBP2-33867] - Analysis in human cell line PC-3 and human cell line HeLa.")
![Immunohistochemistry-Paraffin: TSPAN1 Antibody [NBP2-33867] - Analysis in human kidney and skeletal muscle tissues. Corresponding RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/TSPAN1-Antibody-Immunohistochemistry-Paraffin-NBP2-33867-img0012.jpg "Immunohistochemistry-Paraffin: TSPAN1 Antibody [NBP2-33867] - Analysis in human kidney and skeletal muscle tissues. Corresponding RNA-seq data are presented for the same tissues.")
![Immunocytochemistry/Immunofluorescence: TSPAN1 Antibody [NBP2-33867] - Staining of human cell line A-431 shows localization to nucleoplasm & vesicles. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/TSPAN1-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-33867-img0010.jpg "Immunocytochemistry/Immunofluorescence: TSPAN1 Antibody [NBP2-33867] - Staining of human cell line A-431 shows localization to nucleoplasm & vesicles. Antibody staining is shown in green.")
![Western Blot: TSPAN1 Antibody [NBP2-33867] - Screening of gene in idiopathic pulmonary fibrosis (IPF) and identification of tetraspanin 1 (TSPAN1) in vivo and vitro. Western blotting was used to detect the protein expression of TSPAN1 in A549, alveolar epithelial type II (ATII) cells, MRC-5 and rat fibroblasts. Image collected and cropped by CiteAb from the following publication (//doi.wiley.com/10.1111/jcmm.14258), licensed under a CC-BY license.](http://images.novusbio.com/fullsize/TSPAN1-Antibody-Western-Blot-NBP2-33867-img0019.jpg "Western Blot: TSPAN1 Antibody [NBP2-33867] - Screening of gene in idiopathic pulmonary fibrosis (IPF) and identification of tetraspanin 1 (TSPAN1) in vivo and vitro. Western blotting was used to detect the protein expression of TSPAN1 in A549, alveolar epithelial type II (ATII) cells, MRC-5 and rat fibroblasts. Image collected and cropped by CiteAb from the following publication (//doi.wiley.com/10.1111/jcmm.14258), licensed under a CC-BY license.")
![Immunohistochemistry-Paraffin: TSPAN1 Antibody [NBP2-33867] - Staining of human skeletal muscle shows no positivity in myocytes as expected.](http://images.novusbio.com/fullsize/TSPAN1-Antibody-Immunohistochemistry-Paraffin-NBP2-33867-img0016.jpg "Immunohistochemistry-Paraffin: TSPAN1 Antibody [NBP2-33867] - Staining of human skeletal muscle shows no positivity in myocytes as expected.")
![Immunohistochemistry-Paraffin: TSPAN1 Antibody [NBP2-33867] - Staining of human colon shows weak to moderate cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/TSPAN1-Antibody-Immunohistochemistry-Paraffin-NBP2-33867-img0013.jpg "Immunohistochemistry-Paraffin: TSPAN1 Antibody [NBP2-33867] - Staining of human colon shows weak to moderate cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: TSPAN1 Antibody [NBP2-33867] - Staining of human prostate shows moderate to strong cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/TSPAN1-Antibody-Immunohistochemistry-Paraffin-NBP2-33867-img0014.jpg "Immunohistochemistry-Paraffin: TSPAN1 Antibody [NBP2-33867] - Staining of human prostate shows moderate to strong cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: TSPAN1 Antibody [NBP2-33867] - Staining of human kidney shows moderate to strong cytoplasmic positivity in cells in tubules.](http://images.novusbio.com/fullsize/TSPAN1-Antibody-Immunohistochemistry-Paraffin-NBP2-33867-img0015.jpg "Immunohistochemistry-Paraffin: TSPAN1 Antibody [NBP2-33867] - Staining of human kidney shows moderate to strong cytoplasmic positivity in cells in tubules.")
![Western Blot: TSPAN1 Antibody [NBP2-33867] - Knockdown tetraspanin 1 (TSPAN1) promoted cell migration & transforming growth factor‐ beta 1 (TGF‐ beta 1)‐induced epithelial‐to‐mesenchymal transition‐related proteins in alveolar epithelial cells. A, Wound healing assay following silencing of TSPAN1 in A549 cells. B, Quantification results of wound healing assay. Bar chart represents the ratio of every group to negative control (NC) groups. The data are expressed as the means ± SEM (n = 3), with results representative of three independent experiments. (*P < 0.05 vs NC). C, Transwell migration analysis by silencing TSPAN1 in A549 cells with or without TGF‐ beta 1 treatment (5 ng/mL, 16 h). D, Quantification of transwell migration analysis. The bar chart represents the numbers of migrating cells. The data are expressed as the means ± SEM (n = 3), with results representative of three independent experiments. (**P < 0.01 vs NC). (E,G) Western blot analysis of various proteins by silencing TSPAN1 for 24 h in A549 & alveolar epithelial type II cells with or without TGF‐ beta 1 treatment. F, Quantification of the results in panel (E), & (H) quantification of the results in panel (G). The data are expressed as the means ± SEM (n = 3), with results representative of three independent experiments. (*P < 0.05, **P < 0.01, ***P < 0.001 vs NC 0 h; #P < 0.05, ##P < 0.01, ###P < 0.001 vs NC 12 h; delta P < 0.05, delta delta P < 0.01, delta delta delta P < 0.001 vs NC 24 h) Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/30869194), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/nbp2-33867_rabbit-polyclonal-tspan1-antibody-3102024161366.jpg "Western Blot: TSPAN1 Antibody [NBP2-33867] - Knockdown tetraspanin 1 (TSPAN1) promoted cell migration & transforming growth factor‐ beta 1 (TGF‐ beta 1)‐induced epithelial‐to‐mesenchymal transition‐related proteins in alveolar epithelial cells. A, Wound healing assay following silencing of TSPAN1 in A549 cells. B, Quantification results of wound healing assay. Bar chart represents the ratio of every group to negative control (NC) groups. The data are expressed as the means ± SEM (n = 3), with results representative of three independent experiments. (*P < 0.05 vs NC). C, Transwell migration analysis by silencing TSPAN1 in A549 cells with or without TGF‐ beta 1 treatment (5 ng/mL, 16 h). D, Quantification of transwell migration analysis. The bar chart represents the numbers of migrating cells. The data are expressed as the means ± SEM (n = 3), with results representative of three independent experiments. (**P < 0.01 vs NC). (E,G) Western blot analysis of various proteins by silencing TSPAN1 for 24 h in A549 & alveolar epithelial type II cells with or without TGF‐ beta 1 treatment. F, Quantification of the results in panel (E), & (H) quantification of the results in panel (G). The data are expressed as the means ± SEM (n = 3), with results representative of three independent experiments. (*P < 0.05, **P < 0.01, ***P < 0.001 vs NC 0 h; #P < 0.05, ##P < 0.01, ###P < 0.001 vs NC 12 h; delta P < 0.05, delta delta P < 0.01, delta delta delta P < 0.001 vs NC 24 h) Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/30869194), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![Western Blot: TSPAN1 Antibody [NBP2-33867] - Tetraspanin 1 (TSPAN1) modulates beta‐catenin & phosphorylation of Smad2/3. Immunofluorescence staining analysis of TSPAN1 & phosphorylation of Smad2/3 after transfected with siRNA for TSPAN1 or negative control (NC) in A549 cells with or without TGF‐ beta 1 treatment (5 ng/mL transforming growth factor‐ beta 1 [TGF‐ beta 1] or control) (green: TSPAN1; red: P‐smad2/3; blue: 4′,6‐diamidino‐2‐phenylindole). Magnification: 1200X. (B‐I) Western blot analysis of various proteins after transfected with siRNA or exogenous expression plasmid for TSPAN1 or NC in A549 & alveolar epithelial type II (ATII) cells with or without TGF‐ beta 1 treatment (5 ng/mL; 0, 12, 24 h). B, Proteins of Smad2/3, beta‐catenin & phosphorylation of Smad2/3 were detected by silencing TSPAN1 in A549 cells. C, Quantification of the results in panel (A). D, The proteins expression of Smad2/3, beta‐catenin & phosphorylation of Smad2/3 were detected, using western blotting after silencing TSPAN1 in ATII cells. E, Quantification of the results in panel (D). F, Proteins of Smad2/3, beta‐catenin & phosphorylation of Smad2/3 were detected after overexpression of TSPAN1 in A549 cells. G, Quantification of the results in panel (F). H, Proteins of Smad2/3, beta‐catenin & phosphorylation of Smad2/3 were detected by Western blotting after overexpression of TSPAN1 in ATII cells. I, Quantification of the results in panel (H). J, Phosphorylation of Smad2/3 was detected by Western blotting in intranuclear or cytoplasm after silencing TSPAN1 in A549 cells. K, Quantification of the results in panel (J). The data are expressed as the means ± SEM (n = 3), with results representative of 3 independent experiments. (*P < 0.05, **P < 0.01, ***P < 0.001 vs NC 0 h; #P < 0.05, ##P < 0.01, ###P < 0.001 vs NC 12 h) Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/30869194), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/nbp2-33867_rabbit-polyclonal-tspan1-antibody-31020241611473.jpg "Western Blot: TSPAN1 Antibody [NBP2-33867] - Tetraspanin 1 (TSPAN1) modulates beta‐catenin & phosphorylation of Smad2/3. Immunofluorescence staining analysis of TSPAN1 & phosphorylation of Smad2/3 after transfected with siRNA for TSPAN1 or negative control (NC) in A549 cells with or without TGF‐ beta 1 treatment (5 ng/mL transforming growth factor‐ beta 1 [TGF‐ beta 1] or control) (green: TSPAN1; red: P‐smad2/3; blue: 4′,6‐diamidino‐2‐phenylindole). Magnification: 1200X. (B‐I) Western blot analysis of various proteins after transfected with siRNA or exogenous expression plasmid for TSPAN1 or NC in A549 & alveolar epithelial type II (ATII) cells with or without TGF‐ beta 1 treatment (5 ng/mL; 0, 12, 24 h). B, Proteins of Smad2/3, beta‐catenin & phosphorylation of Smad2/3 were detected by silencing TSPAN1 in A549 cells. C, Quantification of the results in panel (A). D, The proteins expression of Smad2/3, beta‐catenin & phosphorylation of Smad2/3 were detected, using western blotting after silencing TSPAN1 in ATII cells. E, Quantification of the results in panel (D). F, Proteins of Smad2/3, beta‐catenin & phosphorylation of Smad2/3 were detected after overexpression of TSPAN1 in A549 cells. G, Quantification of the results in panel (F). H, Proteins of Smad2/3, beta‐catenin & phosphorylation of Smad2/3 were detected by Western blotting after overexpression of TSPAN1 in ATII cells. I, Quantification of the results in panel (H). J, Phosphorylation of Smad2/3 was detected by Western blotting in intranuclear or cytoplasm after silencing TSPAN1 in A549 cells. K, Quantification of the results in panel (J). The data are expressed as the means ± SEM (n = 3), with results representative of 3 independent experiments. (*P < 0.05, **P < 0.01, ***P < 0.001 vs NC 0 h; #P < 0.05, ##P < 0.01, ###P < 0.001 vs NC 12 h) Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/30869194), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![Immunocytochemistry/ Immunofluorescence: TSPAN1 Antibody [NBP2-33867] - Tetraspanin 1 (TSPAN1) modulates beta‐catenin & phosphorylation of Smad2/3. Immunofluorescence staining analysis of TSPAN1 & phosphorylation of Smad2/3 after transfected w/ siRNA for TSPAN1 or negative control (NC) in A549 cells w/ or w/out TGF‐ beta 1 treatment (5 ng/mL transforming growth factor‐ beta 1 [TGF‐ beta 1] or control) (green: TSPAN1; red: P‐smad2/3; blue: 4′,6‐diamidino‐2‐phenylindole). Magnification: 1200X. (B‐I) Western blot analysis of various proteins after transfected w/ siRNA or exogenous expression plasmid for TSPAN1 or NC in A549 & alveolar epithelial type II (ATII) cells w/ or w/out TGF‐ beta 1 treatment (5 ng/mL; 0, 12, 24 h). B, Proteins of Smad2/3, beta‐catenin & phosphorylation of Smad2/3 detected by silencing TSPAN1 in A549 cells. C, Quantification of Results in panel (A). D, The proteins expression of Smad2/3, beta‐catenin & phosphorylation of Smad2/3 detected, using western blotting after silencing TSPAN1 in ATII cells. E, Quantification of Results in panel (D). F, Proteins of Smad2/3, beta‐catenin & phosphorylation of Smad2/3 detected after overexpression of TSPAN1 in A549 cells. G, Quantification of Results in panel (F). H, Proteins of Smad2/3, beta‐catenin & phosphorylation of Smad2/3 detected by Western blotting after overexpression of TSPAN1 in ATII cells. I, Quantification of Results in panel (H). J, Phosphorylation of Smad2/3 detected by Western blotting in intranuclear or cytoplasm after silencing TSPAN1 in A549 cells. K, Quantification of Results in panel (J). The data are expressed as the means ± SEM (n = 3), w/ results representative of 3 independent experiments. (*P < 0.05, **P < 0.01, ***P < 0.001 vs NC 0 h; #P < 0.05, ##P < 0.01, ###P < 0.001 vs NC 12 h) Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/30869194), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/nbp2-33867_rabbit-polyclonal-tspan1-antibody-310202416121965.jpg "Immunocytochemistry/ Immunofluorescence: TSPAN1 Antibody [NBP2-33867] - Tetraspanin 1 (TSPAN1) modulates beta‐catenin & phosphorylation of Smad2/3. Immunofluorescence staining analysis of TSPAN1 & phosphorylation of Smad2/3 after transfected w/ siRNA for TSPAN1 or negative control (NC) in A549 cells w/ or w/out TGF‐ beta 1 treatment (5 ng/mL transforming growth factor‐ beta 1 [TGF‐ beta 1] or control) (green: TSPAN1; red: P‐smad2/3; blue: 4′,6‐diamidino‐2‐phenylindole). Magnification: 1200X. (B‐I) Western blot analysis of various proteins after transfected w/ siRNA or exogenous expression plasmid for TSPAN1 or NC in A549 & alveolar epithelial type II (ATII) cells w/ or w/out TGF‐ beta 1 treatment (5 ng/mL; 0, 12, 24 h). B, Proteins of Smad2/3, beta‐catenin & phosphorylation of Smad2/3 detected by silencing TSPAN1 in A549 cells. C, Quantification of Results in panel (A). D, The proteins expression of Smad2/3, beta‐catenin & phosphorylation of Smad2/3 detected, using western blotting after silencing TSPAN1 in ATII cells. E, Quantification of Results in panel (D). F, Proteins of Smad2/3, beta‐catenin & phosphorylation of Smad2/3 detected after overexpression of TSPAN1 in A549 cells. G, Quantification of Results in panel (F). H, Proteins of Smad2/3, beta‐catenin & phosphorylation of Smad2/3 detected by Western blotting after overexpression of TSPAN1 in ATII cells. I, Quantification of Results in panel (H). J, Phosphorylation of Smad2/3 detected by Western blotting in intranuclear or cytoplasm after silencing TSPAN1 in A549 cells. K, Quantification of Results in panel (J). The data are expressed as the means ± SEM (n = 3), w/ results representative of 3 independent experiments. (*P < 0.05, **P < 0.01, ***P < 0.001 vs NC 0 h; #P < 0.05, ##P < 0.01, ###P < 0.001 vs NC 12 h) Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/30869194), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![Western Blot: TSPAN1 Antibody [NBP2-33867] - Knockdown tetraspanin 1 (TSPAN1) promoted cell migration & transforming growth factor‐ beta 1 (TGF‐ beta 1)‐induced epithelial‐to‐mesenchymal transition‐related proteins in alveolar epithelial cells. A, Wound healing assay following silencing of TSPAN1 in A549 cells. B, Quantification results of wound healing assay. Bar chart represents the ratio of every group to negative control (NC) groups. The data are expressed as the means ± SEM (n = 3), with results representative of three independent experiments. (*P < 0.05 vs NC). C, Transwell migration analysis by silencing TSPAN1 in A549 cells with or without TGF‐ beta 1 treatment (5 ng/mL, 16 h). D, Quantification of transwell migration analysis. The bar chart represents the numbers of migrating cells. The data are expressed as the means ± SEM (n = 3), with results representative of three independent experiments. (**P < 0.01 vs NC). (E,G) Western blot analysis of various proteins by silencing TSPAN1 for 24 h in A549 & alveolar epithelial type II cells with or without TGF‐ beta 1 treatment. F, Quantification of the results in panel (E), & (H) quantification of the results in panel (G). The data are expressed as the means ± SEM (n = 3), with results representative of three independent experiments. (*P < 0.05, **P < 0.01, ***P < 0.001 vs NC 0 h; #P < 0.05, ##P < 0.01, ###P < 0.001 vs NC 12 h; delta P < 0.05, delta delta P < 0.01, delta delta delta P < 0.001 vs NC 24 h) Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/30869194), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/nbp2-33867_rabbit-polyclonal-tspan1-antibody-31020241611476.jpg "Western Blot: TSPAN1 Antibody [NBP2-33867] - Knockdown tetraspanin 1 (TSPAN1) promoted cell migration & transforming growth factor‐ beta 1 (TGF‐ beta 1)‐induced epithelial‐to‐mesenchymal transition‐related proteins in alveolar epithelial cells. A, Wound healing assay following silencing of TSPAN1 in A549 cells. B, Quantification results of wound healing assay. Bar chart represents the ratio of every group to negative control (NC) groups. The data are expressed as the means ± SEM (n = 3), with results representative of three independent experiments. (*P < 0.05 vs NC). C, Transwell migration analysis by silencing TSPAN1 in A549 cells with or without TGF‐ beta 1 treatment (5 ng/mL, 16 h). D, Quantification of transwell migration analysis. The bar chart represents the numbers of migrating cells. The data are expressed as the means ± SEM (n = 3), with results representative of three independent experiments. (**P < 0.01 vs NC). (E,G) Western blot analysis of various proteins by silencing TSPAN1 for 24 h in A549 & alveolar epithelial type II cells with or without TGF‐ beta 1 treatment. F, Quantification of the results in panel (E), & (H) quantification of the results in panel (G). The data are expressed as the means ± SEM (n = 3), with results representative of three independent experiments. (*P < 0.05, **P < 0.01, ***P < 0.001 vs NC 0 h; #P < 0.05, ##P < 0.01, ###P < 0.001 vs NC 12 h; delta P < 0.05, delta delta P < 0.01, delta delta delta P < 0.001 vs NC 24 h) Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/30869194), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![Bioactivity CTLA-4 [Unconjugated]](https://images.novusbio.com/images2/CTLA4_7268CT_2293.jpg)
![Western Blot CDC14 Antibody (472508) [Unconjugated]](https://images.novusbio.com/images2/CDC14_MAB4457_Western_Blot_6181.jpg)
![Western Blot CDC14 Antibody (472508) [Unconjugated]](https://images.novusbio.com/images2/CDC14_MAB4457_Western_Blot_23533.jpg)
![Flow Cytometry CD151 Antibody (455807) [Unconjugated]](https://images.novusbio.com/images2/CD151_MAB4609_Flow_Cytometry_8473.jpg)
![Immunocytochemistry CD151 Antibody (455807) [Unconjugated]](https://images.novusbio.com/images2/CD151_MAB4609_Immunocytochemistry__Immunofluorescence_19523.jpg)
![Western Blot SOS2 Antibody [Unconjugated]](https://images.novusbio.com/images2/SOS2_AF6260_Western_Blot_9542.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")