Home » Alix » Alix Proteins » Alix Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

Alix Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for Alix Protein (NBP1-90201PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Alix Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PDCD6IP.

Source: E. coli

Amino Acid Sequence: VPVSVQQSLAAYNQRKADLVNRSIAQMREATTLANGVLASLNLPAAIEDVSGDTVPQSILTKSRSVIEQGGIQTVDQLIKELPELLQRNREILDESLRLLDEEEATDND

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PDCD6IP
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-90201.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
30 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Alix Recombinant Protein Antigen

  • AIP1DRIP4
  • ALG-2 interacting protein 1
  • ALG-2 interacting protein X
  • ALG-2-interacting protein 1
  • alinx
  • Alix
  • apoptosis-linked gene 2-interacting protein X
  • dopamine receptor interacting protein 4
  • HP95
  • KIAA1375
  • MGC17003
  • PDCD6-interacting protein
  • programmed cell death 6 interacting protein
  • programmed cell death 6-interacting protein

Background

Alix encodes a protein thought to participate in programmed cell death. Studies using mouse cells have shown that overexpression of this protein can block apoptosis. In addition, the product of this gene binds to the product of the PDCD6 gene, a protein required for apoptosis, in a calcium-dependent manner. This gene product also binds to endophilins, proteins that regulate membrane shape during endocytosis. Overexpression of this gene product and endophilins results in cytoplasmic vacuolization which may be partly responsible for the protection against cell death.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

PDCD6 Antibody
(722232)
MAB6015
Western Blot PDCD6 Antibody (722232)
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB
TSG101 Antibody
(4A10)
NB200-112
Western Blot TSG101 Antibody (4A10)
Immunohistochemistry-Paraffin TSG101 Antibody (4A10)
Immunohistochemistry-Paraffin TSG101 Antibody (4A10)
(2 Reviews)
(99 Publications)
Species: Ca, Ha, Hu, Pm, Mu, Po, Rt, Ze
Applications: EM, ELISA, Flow, ICC/IF, IHC-FrFl, IHC, IHC-P, IP, KD, WB
CHMP4A Antibody
NBP2-49557
Immunohistochemistry-Paraffin CHMP4A Antibody
Species: Hu
Applications: IHC, IHC-P
CHMP4B Antibody
NBP2-87183
Immunohistochemistry-Paraffin CHMP4B Antibody
Western Blot CHMP4B Antibody
Western Blot CHMP4B Antibody
Species: Hu, Mu
Applications: IHC-P, WB
VPS4A Antibody
(SR2511)
NBP3-27784
Western Blot VPS4A Antibody (SR2511)
Immunohistochemistry-Paraffin VPS4A Antibody (SR2511)
Immunocytochemistry/ Immunofluorescence VPS4A Antibody (SR2511)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
CIN85/SH3KBP1
Antibody
NBP1-85614
Western Blot CIN85/SH3KBP1 Antibody
Immunohistochemistry-Paraffin CIN85/SH3KBP1 Antibody
Immunohistochemistry-Paraffin CIN85/SH3KBP1 Antibody
Species: Hu, Mu
Applications: IHC, IHC-P, WB
MAGI2 Antibody
AF7117
Western Blot MAGI2 Antibody
Immunohistochemistry MAGI2 Antibody
Immunocytochemistry MAGI2 Antibody
(1 Publication)
Species: Hu, Mu
Applications: ICC, IHC, WB
Destrin Antibody
(OTI2F7)
NBP2-00527
Flow Cytometry Destrin Antibody (OTI2F7)
Flow Cytometry Destrin Antibody (OTI2F7)
Flow Cytometry Destrin Antibody (OTI2F7)
Species: Ca, Hu, Pm, Mu, Pm
Applications: Flow, ICC/IF, IHC, IHC-P, WB
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(811 Publications)
Species: Hu
Applications: BA
EN-RAGE/S100A12
Antibody [Unconjugate
AF1052
Immunohistochemistry EN-RAGE/S100A12 Antibody [Unconjugated]
Western Blot EN-RAGE/S100A12 Antibody [Unconjugated]
Simple Western EN-RAGE/S100A12 Antibody [Unconjugated]
(3 Reviews)
(7 Publications)
Species: Hu
Applications: CyTOF-ready, Flow, IHC, Simple Western, WB
Exosome Component
9 Antibody - BSA Free
NBP1-71702
Simple Western Exosome Component 9 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence Exosome Component 9 Antibody - BSA Free
Immunohistochemistry Exosome Component 9 Antibody - BSA Free
(2 Reviews)
(4 Publications)
Species: Ch, Hu, Mu
Applications: ChIP, ChIP, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
WDR1 Antibody
NBP2-32665
Western Blot WDR1 Antibody
Immunohistochemistry-Paraffin WDR1 Antibody
Immunohistochemistry-Paraffin WDR1 Antibody
Species: Hu
Applications: IHC, IHC-P, WB
Gelsolin/GSN
Antibody (893205) [Un ...
MAB8170
Simple Western Gelsolin/GSN Antibody (893205) [Unconjugated]
Western Blot Gelsolin/GSN Antibody (893205) [Unconjugated]
Immunohistochemistry Gelsolin/GSN Antibody (893205) [Unconjugated]
(1 Publication)
Species: Hu, Mu, Rt
Applications: IHC, KO, mIF, Simple Western, WB
VPS4B Antibody
NBP2-20881
Western Blot VPS4B Antibody
Immunocytochemistry/ Immunofluorescence VPS4B Antibody
Immunocytochemistry/ Immunofluorescence VPS4B Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Glutathione S
Transferase kappa 1 A ...
NBP2-16686
Western Blot Glutathione S Transferase kappa 1 Antibody
Western Blot Glutathione S Transferase kappa 1 Antibody
Immunohistochemistry-Paraffin Glutathione S Transferase kappa 1 Antibody
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KO, WB
SLCO6A1 Antibody
NBP2-49118
Immunohistochemistry-Paraffin SLCO6A1 Antibody
Immunohistochemistry-Paraffin SLCO6A1 Antibody
Immunohistochemistry-Paraffin SLCO6A1 Antibody
Species: Hu
Applications: IHC, IHC-P
PTPN23 Antibody
H00025930-B01P
Western Blot PTPN23 Antibody
(2 Publications)
Species: Hu
Applications: ICC/IF, WB
Alix Recombinant
Protein Antigen
NBP1-90201PEP
Alix Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for Alix Protein (NBP1-90201PEP) (0)

There are no publications for Alix Protein (NBP1-90201PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Alix Protein (NBP1-90201PEP) (0)

There are no reviews for Alix Protein (NBP1-90201PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Alix Protein (NBP1-90201PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Alix Products

Research Areas for Alix Protein (NBP1-90201PEP)

Find related products by research area.

Blogs on Alix.

Check out the latest blog posts on Alix.
Tools for Isolation, Quantification and Analysis of Exosomes
Exosomes are spherical to cup-shaped bilayered membrane enclosed nanosize vesicles (30-100 nm) which have the ability to shuttle active cargoes between cells. Johnstone et al. 1987 pioneered in documenting the generation of exosomes in differentiat...  Read full blog post.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005
Western Blot: Alix Antibody [NBP1-90201] - Analysis in U-138MG cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-PDCD6IP antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
Alix Antibody
NBP1-90201
Western Blot: TSG101 Antibody (4A10) [NB200-112] - Lane 1: MWM, Lane 2: TSG101 in RAW 264.7 Whole Cell Lysate, Lane 3: Exosome Lysate. Used primary antibody at 1:500 and Donkey Anti-Mouse at 0.5 ug/mL (this could be titrated down to reduce background). Used picogram sensitivity ECL reagents. Image from verified customer review.
TSG101 Antibody (4A10)
NB200-112

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Alix Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol PDCD6IP