![Western Blot: WDR1 Antibody [NBP2-32665] - Analysis in human cell line MOLT-4.](http://images.novusbio.com/fullsize/WDR1-Antibody-Western-Blot-NBP2-32665-img0011.jpg "Western Blot: WDR1 Antibody [NBP2-32665] - Analysis in human cell line MOLT-4.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: EHLLKYEYQPFAGKIKDIAWTEDSKRIAVVGEGREKFGAVFLWDSGSSVGEITGHNKVINSVDIKQSRPYRLATGSDDNCAAFFEGPPFKFKFTI |
| Predicted Species | Mouse (98%), Rat (97%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | WDR1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for WDR1 Antibody (NBP2-32665)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | WDR1 |
![Immunohistochemistry-Paraffin: WDR1 Antibody [NBP2-32665] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.](http://images.novusbio.com/fullsize/WDR1-Antibody-Immunohistochemistry-Paraffin-NBP2-32665-img0015.jpg "Immunohistochemistry-Paraffin: WDR1 Antibody [NBP2-32665] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.")
![Immunohistochemistry-Paraffin: WDR1 Antibody [NBP2-32665] - Staining of human endometrium shows strong cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/WDR1-Antibody-Immunohistochemistry-Paraffin-NBP2-32665-img0012.jpg "Immunohistochemistry-Paraffin: WDR1 Antibody [NBP2-32665] - Staining of human endometrium shows strong cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: WDR1 Antibody [NBP2-32665] - Staining of human prostate shows moderate cytoplasmic positivity in smooth muscle and glandular cells.](http://images.novusbio.com/fullsize/WDR1-Antibody-Immunohistochemistry-Paraffin-NBP2-32665-img0013.jpg "Immunohistochemistry-Paraffin: WDR1 Antibody [NBP2-32665] - Staining of human prostate shows moderate cytoplasmic positivity in smooth muscle and glandular cells.")
![Immunohistochemistry-Paraffin: WDR1 Antibody [NBP2-32665] - Staining of human duodenum shows strong cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/WDR1-Antibody-Immunohistochemistry-Paraffin-NBP2-32665-img0014.jpg "Immunohistochemistry-Paraffin: WDR1 Antibody [NBP2-32665] - Staining of human duodenum shows strong cytoplasmic positivity in glandular cells.")
![Simple Western Gelsolin/GSN Antibody (893205) [Unconjugated]](https://images.novusbio.com/images2/Gelsolin_MAB8170_Simple_Western_17259.jpg)
![Western Blot Gelsolin/GSN Antibody (893205) [Unconjugated]](https://images.novusbio.com/images2/Gelsolin_MAB8170_Western_Blot_14481.jpg)
![Immunohistochemistry Gelsolin/GSN Antibody (893205) [Unconjugated]](https://images.novusbio.com/images2/Gelsolin_MAB8170_Immunohistochemistry_14553.jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![Western Blot JNK1 Antibody (228601) [Unconjugated]](https://images.novusbio.com/images2/JNK1_MAB17761_Western_Blot_5991.jpg)
![Western Blot JNK1 Antibody (228601) [Unconjugated]](https://images.novusbio.com/images2/JNK1_MAB17761_Western_Blot_6327.jpg)
![Immunocytochemistry JNK1 Antibody (228601) [Unconjugated]](https://images.novusbio.com/images2/JNK1_MAB17761_Immunocytochemistry__Immunofluorescence_20184.jpg)
![Western Blot Angiopoietin-like Protein 2/ANGPTL2 Antibody [Unconjugated]](https://images.novusbio.com/images2/Angiopoietinlike_Protein_2_AF1444_Western_Blot_19840.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")