![Immunocytochemistry/Immunofluorescence: ALDH8A1 Antibody [NBP2-38753] - Staining of human cell line Hep G2 shows localization to centrosome.](http://images.novusbio.com/fullsize/ALDH8A1-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-38753-img0002.jpg "Immunocytochemistry/Immunofluorescence: ALDH8A1 Antibody [NBP2-38753] - Staining of human cell line Hep G2 shows localization to centrosome.")
| Reactivity | HuSpecies Glossary |
| Applications | ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: AEGAQIWCGEGVDKLSLPARNQAGYFMLPTVITDIKDESCCMTEEIFGPVTCVVPFDSEEEVIERANNVKYGLAATVWSSNVGRVHRVAKKLQSGLVW |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | ALDH8A1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry-Paraffin: ALDH8A1 Antibody [NBP2-38753] - Staining of human kidney.](http://images.novusbio.com/fullsize/ALDH8A1-Antibody-Immunohistochemistry-Paraffin-NBP2-38753-img0011.jpg "Immunohistochemistry-Paraffin: ALDH8A1 Antibody [NBP2-38753] - Staining of human kidney.")
![Immunohistochemistry-Paraffin: ALDH8A1 Antibody [NBP2-38753] - Staining of human liver shows high expression.](http://images.novusbio.com/fullsize/ALDH8A1-Antibody-Immunohistochemistry-Paraffin-NBP2-38753-img0004.jpg "Immunohistochemistry-Paraffin: ALDH8A1 Antibody [NBP2-38753] - Staining of human liver shows high expression.")
![Immunohistochemistry-Paraffin: ALDH8A1 Antibody [NBP2-38753] - Staining of human pancreas shows low expression as expected.](http://images.novusbio.com/fullsize/ALDH8A1-Antibody-Immunohistochemistry-Paraffin-NBP2-38753-img0005.jpg "Immunohistochemistry-Paraffin: ALDH8A1 Antibody [NBP2-38753] - Staining of human pancreas shows low expression as expected.")
![Immunohistochemistry-Paraffin: ALDH8A1 Antibody [NBP2-38753] - Staining in human liver and pancreas tissues using anti-ALDH8A1 antibody. Corresponding ALDH8A1 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/ALDH8A1-Antibody-Immunohistochemistry-Paraffin-NBP2-38753-img0006.jpg "Immunohistochemistry-Paraffin: ALDH8A1 Antibody [NBP2-38753] - Staining in human liver and pancreas tissues using anti-ALDH8A1 antibody. Corresponding ALDH8A1 RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: ALDH8A1 Antibody [NBP2-38753] - Staining of human cerebral cortex, kidney, liver and lymph node using Anti-ALDH8A1 antibody NBP2-38753 (A) shows similar protein distribution across tissues to independent antibody NBP1-89151 (B).](http://images.novusbio.com/fullsize/ALDH8A1-Antibody-Immunohistochemistry-Paraffin-NBP2-38753-img0007.jpg "Immunohistochemistry-Paraffin: ALDH8A1 Antibody [NBP2-38753] - Staining of human cerebral cortex, kidney, liver and lymph node using Anti-ALDH8A1 antibody NBP2-38753 (A) shows similar protein distribution across tissues to independent antibody NBP1-89151 (B).")
![Immunohistochemistry-Paraffin: ALDH8A1 Antibody [NBP2-38753] - Staining of human pancreas shows low expression as expected.](http://images.novusbio.com/fullsize/ALDH8A1-Antibody-Immunohistochemistry-Paraffin-NBP2-38753-img0008.jpg "Immunohistochemistry-Paraffin: ALDH8A1 Antibody [NBP2-38753] - Staining of human pancreas shows low expression as expected.")
![Immunohistochemistry-Paraffin: ALDH8A1 Antibody [NBP2-38753] - Staining of human lymph node.](http://images.novusbio.com/fullsize/ALDH8A1-Antibody-Immunohistochemistry-Paraffin-NBP2-38753-img0009.jpg "Immunohistochemistry-Paraffin: ALDH8A1 Antibody [NBP2-38753] - Staining of human lymph node.")
![Immunohistochemistry-Paraffin: ALDH8A1 Antibody [NBP2-38753] - Staining of human cerebral cortex.](http://images.novusbio.com/fullsize/ALDH8A1-Antibody-Immunohistochemistry-Paraffin-NBP2-38753-img0010.jpg "Immunohistochemistry-Paraffin: ALDH8A1 Antibody [NBP2-38753] - Staining of human cerebral cortex.")
![Immunocytochemistry Aldehyde Dehydrogenase 1-A1/ALDH1A1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Aldehyde_Dehydrogenase_1-A1_AF5869_Immunocytochemistry_10308.jpg)
![Immunohistochemistry Aldehyde Dehydrogenase 1-A1/ALDH1A1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Aldehyde_Dehydrogenase_1-A1_AF5869_Immunohistochemistry_10638.jpg)
![Simple Western Aldehyde Dehydrogenase 1-A1/ALDH1A1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Aldehyde_Dehydrogenase_1A1_AF5869_Simple_Western_17067.jpg)
![N/A Erythropoietin/EPO [HRP]](https://images.novusbio.com/images2/DATA_Erythropoietin_MEP00_ELISA_970.jpg)
![N/A Erythropoietin/EPO [HRP]](https://images.novusbio.com/images2/Erythropoietin_MEP00_ELISA_421.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")