![Western Blot: FBXO7 Antibody [H00025793-B01P] - Analysis of FBXO7 expression in human placenta.](http://images.novusbio.com/fullsize/FBXO7-Antibody-Western-Blot-H00025793-B01P-img0003.jpg "Western Blot: FBXO7 Antibody [H00025793-B01P] - Analysis of FBXO7 expression in human placenta.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Immunogen | FBXO7 (AAH08361.1, 1 a.a. - 522 a.a.) full-length human protein. MRLRVRLLKRTWPLEVPETEPTLGHLRSHLRQSLLCTWGYSSNTRFTITLNYKDPLTGDEETLASYGIVSGDLICLILQDDIPAPNIPSSTDSEHSSLQNNEQPSLATSSNQTSIQDEQPSDSFQGQAAQSGVWNDDSMLGPSQNFEAESIQDNAHMAEGTGFYPSEPMLCSESVEGQVPHSLETLYQSADCSDANDALIVLIHLLMLESGYIPQGTEAKALSMPEKWKLSGVYKLQYMHPLCEGSSATLTCVPLGNLIVVNATLKINNEIRSVKRLQLLPESFICKEKLGENVANIYKDLQKLSRLFKDQLVYPLLAFTRQALNLPDVFGLVVLPLELKLRIFRLLDVRSVLSLSAVCRDLFTASNDPLLWRFLYLRDFRDNTVRVQDTDWKELYRKRHIQRKESPKGRFVMLLPSSTHTIPFYPNPLHPRPFPSSRLPPGIIGGEYDQRPTLPYVGDPISSLIPGPGETPSQFPPLRPRFDPVGPLPGPNPILPGRGGPNDRFPFRPSRGRPTDGRLSFM |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Mouse |
| Gene | FBXO7 |
| Purity | Protein G purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Application Notes | This antibody is useful for Western Blot, Functional, Immunofluorescence, Immunohistochemistry-Paraffin |
|
| Publications |
|
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.4) |
| Preservative | No Preservative |
| Purity | Protein G purified |
| Publication using H00025793-B01P | Applications | Species |
|---|---|---|
| Chen CM, Chen IC, Huang YC et al. FBXO7 Y52C Polymorphism as a Potential Protective Factor in Parkinson's Disease. PLoS One. 2014-07-16 [PMID: 25029497] |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | FBXO7 |
| Uniprot |
|
![Immunocytochemistry/Immunofluorescence: FBXO7 Antibody [H00025793-B01P] - Analysis of purified antibody to FBXO7 on HeLa cell. (antibody concentration 10 ug/ml)](http://images.novusbio.com/fullsize/FBXO7-Antibody-Immunocytochemistry-Immunofluorescence-H00025793-B01P-img0001.jpg "Immunocytochemistry/Immunofluorescence: FBXO7 Antibody [H00025793-B01P] - Analysis of purified antibody to FBXO7 on HeLa cell. (antibody concentration 10 ug/ml)")
![Immunohistochemistry-Paraffin: FBXO7 Antibody [H00025793-B01P] - Analysis of purified antibody to FBXO7 on formalin-fixed paraffin-embedded human testis. (antibody concentration 3 ug/ml)](http://images.novusbio.com/fullsize/FBXO7-Antibody-Immunohistochemistry-Paraffin-H00025793-B01P-img0002.jpg "Immunohistochemistry-Paraffin: FBXO7 Antibody [H00025793-B01P] - Analysis of purified antibody to FBXO7 on formalin-fixed paraffin-embedded human testis. (antibody concentration 3 ug/ml)")
![Western Blot: FBXO7 Antibody [H00025793-B01P] - Analysis of FBXO7 expression in transfected 293T cell line by FBXO7 polyclonal antibody. Lane 1: FBXO7 transfected lysate(57.42 KDa). Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/FBXO7-Antibody-Western-Blot-H00025793-B01P-img0004.jpg "Western Blot: FBXO7 Antibody [H00025793-B01P] - Analysis of FBXO7 expression in transfected 293T cell line by FBXO7 polyclonal antibody. Lane 1: FBXO7 transfected lysate(57.42 KDa). Lane 2: Non-transfected lysate.")
![Western Blot Parkin Antibody [Unconjugated]](https://images.novusbio.com/images2/Parkin_AF1438_Western_Blot_22174.jpg)
![Immunohistochemistry Parkin Antibody [Unconjugated]](https://images.novusbio.com/images2/Parkin_AF1438_Immunohistochemistry_6700.jpg)
![Western Blot Bone marrow stromal cell antigen 1/CD157 Antibody [Unconjugated]](https://images.novusbio.com/images2/CD157_AF4736_Western_Blot_9316.jpg)
![Flow Cytometry: Mouse IgG Isotype Control [NBP1-97019]](https://images.novusbio.com/images/Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP1-97019-img0004.jpg "Flow Cytometry: Mouse IgG Isotype Control [NBP1-97019]")