![Western Blot: DLG7/HURP Antibody [NBP1-87976] - Analysis in human cell lines U2OS and SK-MEL-30 using anti-DLGAP5 antibody. Corresponding DLGAP5 RNA-seq data are presented for the same cell lines. Loading control: anti-PPIB.](http://images.novusbio.com/fullsize/DLG7-HURP-Antibody-Western-Blot-NBP1-87976-img0013.jpg "Western Blot: DLG7/HURP Antibody [NBP1-87976] - Analysis in human cell lines U2OS and SK-MEL-30 using anti-DLGAP5 antibody. Corresponding DLGAP5 RNA-seq data are presented for the same cell lines. Loading control: anti-PPIB.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: ASRHRKDISTEMIRTKIAHRKSLSQKENRHKEYERNRHFGLKDVNIPTLEGRILVELDETSQGLVPEKTNVKPRAMKTILGDQRKQMLQKYKEEKQLQKLKEQREKAKRGIFKVGRYRPDMPCFLLSNQNAVKAE |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | DLGAP5 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for DLG7/HURP Antibody (NBP1-87976)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | DLGAP5 |
![Immunocytochemistry/Immunofluorescence: DLG7/HURP Antibody [NBP1-87976] - Staining of human cell line A-431 shows localization to cytosol & microtubule organizing center. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/DLG7-HURP-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-87976-img0009.jpg "Immunocytochemistry/Immunofluorescence: DLG7/HURP Antibody [NBP1-87976] - Staining of human cell line A-431 shows localization to cytosol & microtubule organizing center. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: DLG7/HURP Antibody [NBP1-87976] - Staining of human liver shows no positivity in hepatocytes as expected.](http://images.novusbio.com/fullsize/DLG7-HURP-Antibody-Immunohistochemistry-Paraffin-NBP1-87976-img0017.jpg "Immunohistochemistry-Paraffin: DLG7/HURP Antibody [NBP1-87976] - Staining of human liver shows no positivity in hepatocytes as expected.")
![Immunohistochemistry-Paraffin: DLG7/HURP Antibody [NBP1-87976] - Staining of human pancreas shows low expression as expected.](http://images.novusbio.com/fullsize/DLG7-HURP-Antibody-Immunohistochemistry-Paraffin-NBP1-87976-img0010.jpg "Immunohistochemistry-Paraffin: DLG7/HURP Antibody [NBP1-87976] - Staining of human pancreas shows low expression as expected.")
![Immunohistochemistry-Paraffin: DLG7/HURP Antibody [NBP1-87976] - Staining of human testis shows high expression.](http://images.novusbio.com/fullsize/DLG7-HURP-Antibody-Immunohistochemistry-Paraffin-NBP1-87976-img0011.jpg "Immunohistochemistry-Paraffin: DLG7/HURP Antibody [NBP1-87976] - Staining of human testis shows high expression.")
![Immunohistochemistry-Paraffin: DLG7/HURP Antibody [NBP1-87976] - Analysis in human testis and liver tissues using NBP1-87976 antibody. Corresponding DLGAP5 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/DLG7-HURP-Antibody-Immunohistochemistry-Paraffin-NBP1-87976-img0014.jpg "Immunohistochemistry-Paraffin: DLG7/HURP Antibody [NBP1-87976] - Analysis in human testis and liver tissues using NBP1-87976 antibody. Corresponding DLGAP5 RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: DLG7/HURP Antibody [NBP1-87976] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts.](http://images.novusbio.com/fullsize/DLG7-HURP-Antibody-Immunohistochemistry-Paraffin-NBP1-87976-img0015.jpg "Immunohistochemistry-Paraffin: DLG7/HURP Antibody [NBP1-87976] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts.")
![Immunohistochemistry-Paraffin: DLG7/HURP Antibody [NBP1-87976] - Staining of human tonsil shows moderate cytoplasmic positivity in germinal center cells.](http://images.novusbio.com/fullsize/DLG7-HURP-Antibody-Immunohistochemistry-Paraffin-NBP1-87976-img0016.jpg "Immunohistochemistry-Paraffin: DLG7/HURP Antibody [NBP1-87976] - Staining of human tonsil shows moderate cytoplasmic positivity in germinal center cells.")
![Immunohistochemistry-Paraffin: DLG7/HURP Antibody [NBP1-87976] - Staining of human pancreas shows no positivity in exocrine or endocrine glandular cells as expected.](http://images.novusbio.com/fullsize/DLG7-HURP-Antibody-Immunohistochemistry-Paraffin-NBP1-87976-img0018.jpg "Immunohistochemistry-Paraffin: DLG7/HURP Antibody [NBP1-87976] - Staining of human pancreas shows no positivity in exocrine or endocrine glandular cells as expected.")
![SCF/c-kit Ligand [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "SCF/c-kit Ligand [Unconjugated]")
![Immunohistochemistry Cyclin B1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Cyclin_B1_AF6000_Immunohistochemistry_11792.jpg)
![Western Blot Cyclin B1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Cyclin_B1_AF6000_Western_Blot_9526.jpg)
![Simple Western Cyclin B1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Cyclin_B1_AF6000_Simple_Western_20094.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")